DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34454 and SPINK4

DIOPT Version :10

Sequence 1:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_055286.1 Gene:SPINK4 / 27290 HGNCID:16646 Length:86 Species:Homo sapiens


Alignment Length:81 Identity:27/81 - (33%)
Similarity:36/81 - (44%) Gaps:11/81 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SANLVLVNNVRIPGGLTPFVPAPAPTKEFLNC--FGNCPTTSQY-NPICGSNMQLYMNEEKFNCA 109
            :|.||:...|.:..|..||...|.       |  ....||.||. |.:||::...|.||.:...|
Human    13 AALLVVDREVPVAAGKLPFSRMPI-------CEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLA 70

  Fly   110 RF-CGADIQIVRRGSC 124
            |. ...||||::.|.|
Human    71 RIKTKQDIQIMKDGKC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 KAZAL_FS 86..124 CDD:412159 15/39 (38%)
SPINK4NP_055286.1 KAZAL_FS 42..86 CDD:412159 17/43 (40%)

Return to query results.
Submit another query.