DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34454 and SPINK4

Sequence 1:NP_001097457.1 Gene:CG34454 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_055286.1 Gene:SPINK4 HGNCID:16646 Length:86 Species:Homo sapiens

Alignment Length:81 Identity:27/82 (33%)
Similarity:36/82 (44%) Gaps:11/82 (13%)


  Fly    48 SANLVLVNNVRIPGGLTPFVPAPAPTKEFLNC--FGNCPTTSQY-NPICGSNMQLYMNEEKFNCA 109
            :|.||:...|.:..|..||...|.       |  ....||.||. |.:||::...|.||.:...|
Human    13 AALLVVDREVPVAAGKLPFSRMPI-------CEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLA 70

  Fly   110 RF-CGADIQIVRRGSC 124
            |. ...||||::.|.|
Human    71 RIKTKQDIQIMKDGKC 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 8/28 (29%)
KAZAL_FS 78..124 CDD:294071 18/50 (36%)
SPINK4NP_055286.1 KAZAL_FS 42..86 CDD:320757 17/44 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21179
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.