DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34454 and Spink4

Sequence 1:NP_001097457.1 Gene:CG34454 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_035593.2 Gene:Spink4 MGIID:1341848 Length:86 Species:Mus musculus

Alignment Length:44 Identity:18/45 (40%)
Similarity:22/45 (49%) Gaps:3/45 (7%)


  Fly    82 NCPTTSQYNPICGSNMQLYMNEEKFNCARF-CGADIQIVRRGSC 124
            |||.|.  |.|||::...|.||......|. ...||||::.|.|
Mouse    45 NCPQTP--NLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966
KAZAL_FS 78..124 CDD:294071 17/43 (40%)
Spink4NP_035593.2 KAZAL_FS 42..86 CDD:294071 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21179
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.