DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34454 and CG42846

Sequence 1:NP_001097457.1 Gene:CG34454 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001189014.1 Gene:CG42846 FlyBaseID:FBgn0262035 Length:167 Species:Drosophila melanogaster

Alignment Length:56 Identity:11/57 (19%)
Similarity:18/57 (32%) Gaps:21/57 (37%)


  Fly    31 SPW----NNAAATTSIPISPTSANLVLVN----------------NVRIPGGLTPF 66
            |.|    |:....|.: :.|..:...:||                |..:||...|:
  Fly   108 SVWVASNNHQPGVTGV-LQPNPSQGKIVNPPFVIGKNNGSFYSTYNATVPGRTYPY 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 11/57 (19%)
KAZAL_FS 78..124 CDD:294071
CG42846NP_001189014.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134462951
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.