DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RCN3 and CG31650

Sequence 1:XP_024307388.1 Gene:RCN3 HGNCID:21145 Length:365 Species:Homo sapiens
Sequence 2:NP_001162879.1 Gene:CG31650 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster

Alignment Length:387 Identity:121/388 (31%)
Similarity:179/388 (46%) Gaps:79/388 (20%)


Human     5 PSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQA------------APLSDAPH--DDAHGNFQYD 55
            |..|..:.||  .|.| |.|..|.......|:.            || .||.|  :|...|.::|
  Fly     9 PLTLCAVALL--AAVG-PMPAHGAVANSHKHEKHLSKERVKDGIYAP-RDAHHHGEDGEHNVEFD 69

Human    56 HEAFLGR-EVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVS 119
            |||.:|. :.|:|||.|:|:||:.||..::..||.  :.|.::...||:|||..:.::...:..:
  Fly    70 HEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDL--NKDEFIDRHELKAWILRSFKKLSEEEAA 132

Human   120 AAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFH----DVEDAETYKKMLARDERRFRVADQDGD 180
            ..::..|.|.|.|:.|:|....||.  ...|:|.    |.:..|..:||:.:|:..|..||.:.|
  Fly   133 DRFEEIDQDADERITWKEYLQDTYA--MEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKD 195

Human   181 SMATREELTAFLHPEEFPHMRDIVIALPGAKFPREPLTLTPGVQPPPGARVIGPQPQCPFLLQET 245
            .:.|.||...|.:|||.|.|                                     .|.||:.|
  Fly   196 GVLTLEEFVLFQNPEEHPQM-------------------------------------LPILLEHT 223

Human   246 LEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPP 310
            ::|.|.:.||.:..:|::.|..|    ..:..|:.||:::|....|.|.||.|.|.||..|::|.
  Fly   224 MQDKDADHDGKINFQEFVGDAAS----HHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPS 284

Human   311 ----AQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTR-HH--DEL 365
                |.|    |.:||...:|.|.|.|||..|||.|::.||||:||:||:.|.. :|  |||
  Fly   285 NTAIAND----EVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RCN3XP_024307388.1 EFh_CREC_RCN3 44..348 CDD:320028 96/315 (30%)
EF-hand motif 44..73 CDD:320028 13/32 (41%)
EF-hand motif 79..110 CDD:320028 10/31 (32%)
EF-hand motif 117..146 CDD:320028 8/29 (28%)
EF-hand motif 167..196 CDD:320028 11/29 (38%)
EF-hand motif 204..270 CDD:320028 11/66 (17%)
EF-hand motif 282..311 CDD:320028 12/33 (36%)
EF-hand motif 318..348 CDD:320028 15/30 (50%)
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 14/55 (25%)
EFh 100..153 CDD:298682 14/55 (25%)
EF-hand_7 184..241 CDD:290234 22/94 (23%)
EFh 184..241 CDD:298682 22/94 (23%)
EFh 228..281 CDD:298682 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D372250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.