DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: creb1a and kay

Sequence 1:NP_957203.1 Gene:creb1a ZFINID:ZDB-GENE-040426-750 Length:318 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:351 Identity:68/352 (19%)
Similarity:114/352 (32%) Gaps:134/352 (38%)


Zfish     5 AGADVQQGGDTAVSETDTQQIAT----------LAQVSMAAAQASATAPTVTLVQ---------- 49
            ||:|.....:.|:   |..:|||          |.......:..:.|.||:|...          
  Fly   205 AGSDNNHSDNFAM---DASEIATFLANELFLQQLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGH 266

Zfish    50 -LPNGQTVQVHGVIQAAQPSVIQS----------------PQVQTVQISTIAESDDSQESVDSVT 97
             |.:.||.:|.|....|.|.|:.:                |..||..:| :.:..:|::|..|..
  Fly   267 LLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIPTGVSSLPLQQTFDLS-LGQGSESEDSNASYN 330

Zfish    98 DSQKRREILSRRPSYRKILNDLSSDAPAVPRIEEEKSEEDSTPAITTVTVPTPIYQTSSGQYIAI 162
            |:|                            :.||:...|::.|           .|.|..|   
  Fly   331 DTQ----------------------------MNEEQDTTDTSSA-----------HTDSTSY--- 353

Zfish   163 TQGGAIQLANNGTDGVQGLQTLTMTNAAGAQPGTTILQYAQTSDGQQILVPSNQVVVQAASGDVQ 227
             |.|.|...:              .|..|....:.:|....:|.|...:..||            
  Fly   354 -QAGHIMAGS--------------VNGGGVNNFSNVLAAVSSSRGSASVGSSN------------ 391

Zfish   228 AYQIRTAAASTIAPGVVMASSPALPSQG---------AEEATRKREVRLMKNREAARECRRKKKE 283
                    |:|       :::||....|         ..|..:||.||..:|::||..||:::.:
  Fly   392 --------ANT-------SNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVD 441

Zfish   284 YVKCLENRVAVLENQNKTLIEELKAL 309
            ....|...|..||.:.:::.:|::.|
  Fly   442 QTNELTEEVEQLEKRGESMRKEIEVL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
creb1aNP_957203.1 pKID 91..131 CDD:280355 4/40 (10%)
bZIP_CREB1 262..316 CDD:269838 15/49 (31%)
coiled coil 263..315 CDD:269838 14/48 (29%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 15/49 (31%)
coiled coil 421..480 CDD:269869 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.