DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP8B2 and CG33298

Sequence 1:NP_065185.1 Gene:ATP8B2 HGNCID:13534 Length:1223 Species:Homo sapiens
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1301 Identity:419/1302 (32%)
Similarity:655/1302 (50%) Gaps:249/1302 (19%)


Human    42 PPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLFEQFQEVANTYFLFLLILQLIPQI 106
            ||:..:|...|.       |:..|.|:|:||.:|:|:|.||.|||..|||.||:|:::|..:|:|
  Fly   237 PPKTPKRDHPNG-------QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEI 294

Human   107 SSLSWFTTIVPLVLVLTITAVKDATDDYFRHKSDNQVNNRQSQVLINGILQ---QEQWMNVCVGD 168
            |:......::|::.||.:|||||..:|..|..||.::||...:| .:|..:   :.:|..:.|||
  Fly   295 SAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRV-YDGETERYKKVKWQELRVGD 358

Human   169 IIKLENNQFVAADLLLLSSSEPHGLCYIETAELDGETNMKVRQAIPVTSELGDISKLAKFDGEVI 233
            |:.|.||:.|.||:|||.:|:|.|:|||:|.:||||||:|.|:.:....|:..|...:||...|.
  Fly   359 IVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVE 423

Human   234 CEPPNNKLDKFSGTL-YWKENKFPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKF 297
            .:.|..||.:|.|.| :....:.|:|.:.:|||...|:||::..|:|::||.:||.|.|:...::
  Fly   424 ADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRY 488

Human   298 KRTSIDRLMNTLVLWIFGFLVCMGVILAIGNAIWEHEVGMRFQV-YLPWDEAVDSAFFSGFLSFW 361
            ||:.:::.||..|:|....|:.:.|:.|||..:|.... ..|.| |||.::.  :|.......||
  Fly   489 KRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSF-THFPVPYLPPNKL--TANMESMWIFW 550

Human   362 SYIIILNTVVPISLYVSVEVIRLGHSYFINWDKKMFCMKKRTPAEARTTTLNEELGQVEYIFSDK 426
            :||:||..::|:||||::|:.::...:.|:.:..:|..:.....|.|...:.|||||:::||:||
  Fly   551 TYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDK 615

Human   427 TGTLTQNIMVFNKCSINGHSYGDVFDVLGHKAELGERPEPVDFSFNPLADKKFLFWDPSLLEAVK 491
            |||||:|.|:|.:|.:||..|......|.........|.|      ||.....|..|.:.|....
  Fly   616 TGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAP------PLIPNDNLNSDMAQLTQGT 674

Human   492 IGDPHT---HEFFRLLSLCHTVM------------------------------------------ 511
            ...||.   .||..:|::|:||:                                          
  Fly   675 YLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASST 739

Human   512 ----------------------------------------------------------------- 511
                                                                             
  Fly   740 STTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAES 804

Human   512 -----SEE-----KNE-------------------------------------------GELY-- 521
                 ||.     ||:                                           |.:|  
  Fly   805 SPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRT 869

Human   522 ------YKAQSPDEGALVTAARNFGFVFRSRTPKTITVH--EMGTAITYQLLAILDFNNIRKRMS 578
                  |:|:||||.|||.||.::.....:|:|..|.|.  ..|....|::|.:|.|::.||.||
  Fly   870 ADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMS 934

Human   579 VIVRN-PEGKIRLYCKGADT----ILLDRLHHSTQELL-NTTMDHLNEYAGEGLRTLVLAYKDLD 637
            ::||. ...:|.||.||||:    :|:...|:|.:.:| ..|...|:.||.||||.||:|.:.|:
  Fly   935 IVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLN 999

Human   638 EEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMMLLGATAIEDKLQQGVPETIALLTLANIK 702
            ...|.:|..|..:..::.::||.||...:.::|:|:.|||||.|||:||.|||||||.|..|.|.
  Fly  1000 SADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGIS 1064

Human   703 IWVLTGDKQETAVNIGYSCKMLTDDMTEVFIVTGHTVLEVREELRKAREKMMDSSRSVGNGFTYQ 767
            :|||||||.|||:||.||.|:.|..|                ||.:...:..|::.:..|  .|.
  Fly  1065 VWVLTGDKPETAINIAYSAKLFTQQM----------------ELIRLTARSRDAAETAIN--FYL 1111

Human   768 DKLSSSKLTSVL----EAVAGEYALVINGHSLAHALE--ADMELEFLETACACKAVICCRVTPLQ 826
            ..:.:.|.||.|    .....:.|||::|.:|...|:  :.:.|.||..:..|.:|:|||.||||
  Fly  1112 TDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQ 1176

Human   827 KAQVVELVKKYKKAVTLAIGDGANDVSMIKTAHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLL 891
            ||.:|::||:.....||||||||||||||:.|.:|||||||||:|||:|:|::..:|::|:||||
  Fly  1177 KAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLL 1241

Human   892 VHGRWSYLRMCKFLCYFFYKNFAFTMVHFWFGFFCGFSAQTVYDQYFITLYNIVYTSLPVLAMGV 956
            .||.|.|.|:.:.:.||||||.||..:.||:..:||||.|.:.||.::.|||:::||||.||:||
  Fly  1242 AHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGV 1306

Human   957 FDQDVPEQRSMEYPKLYEPGQLNLLFNKREFFICIAQGIYTSVLMFFIPYGVFADATRDDGTQLA 1021
            :|:.|.|...::.|.||:.|:|.:.:...:|::.:...:|.|:::||:....:|::  |.|    
  Fly  1307 YDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAES--DVG---- 1365

Human  1022 DYQSFAVTVATSLVIVVSVQIGLDTGYWTAINHFFIWGSLAVY--FAILF---AMHSNGLFDMFP 1081
             ...|..|:..|.:....|...::...||.::...|..||..:  |||::   .|:..|:...:.
  Fly  1366 -IWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYW 1429

Human  1082 NQFRFVGNAQNTLAQPTVWLTIVLTTVVCIMPVVAFRFLRLNLKPDLSDTVRYTQLVRKKQKAQH 1146
            ..|....:|.:       ||.|:|:|||.::|.:....:|::|.||.|     |:::.:.::.:.
  Fly  1430 VIFVCFASAVH-------WLVIMLSTVVAVLPRLLLTTVRISLCPDDS-----TKVILQSKRERS 1482

Human  1147 R 1147
            |
  Fly  1483 R 1483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP8B2NP_065185.1 PhoLip_ATPase_N 51..113 CDD:292826 25/62 (40%)
ATPase-Plipid 62..1133 CDD:273734 412/1266 (33%)
Cation_ATPase 506..602 CDD:289987 43/271 (16%)
HAD_like <830..873 CDD:304363 29/43 (67%)
PhoLip_ATPase_C 873..1127 CDD:292829 85/259 (33%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 413/1270 (33%)
E1-E2_ATPase 302..>394 CDD:278548 40/93 (43%)
Cation_ATPase <880..965 CDD:289987 32/85 (38%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.