DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SALL4 and drm

DIOPT Version :9

Sequence 1:	NP_065169.1	Gene:	SALL4 / 57167	HGNCID:	15924	Length:	1053	Species:	Homo sapiens
Sequence 2:	NP_001285590.1	Gene:	drm / 49638	FlyBaseID:	FBgn0024244	Length:	88	Species:	Drosophila melanogaster

Alignment Length:	73	Identity:	25/73 - (34%)
Similarity:	35/73 - (47%)	Gaps:	6/73 - (8%)

- Green bases have known domain annotations that are detailed below.

Human   577 CQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVML 641
            |:|..:...|.   :..|.||.|.|.|:...||..|   .||:.|.:..:||.:|.|.|.....|
  Fly    12 CRSDFRRKMRP---KCEFICKYCQRRFTKPYNLMIH---ERTHKSPEITYSCEVCGKYFKQRDNL 70

Human   642 QQHIRMHM 649
            :||..:||
  Fly    71 RQHRNLHM 78

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SALL4	NP_065169.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..62
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..149
		zf-C2H2	382..404	CDD:306579
		C2H2 Zn finger	384..404	CDD:275368
		zf-H2C2_2	396..421	CDD:316026
		C2H2 Zn finger	412..432	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	483..546
		C2H2 Zn finger	568..588	CDD:275368	3/10 (30%)
		zf-H2C2_2	580..605	CDD:316026	7/24 (29%)
		C2H2 Zn finger	596..619	CDD:275368	9/22 (41%)
		zf-C2H2	626..648	CDD:306579	8/21 (38%)
		C2H2 Zn finger	628..648	CDD:275368	7/19 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	694..714
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	736..776
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	788..828
		C2H2 Zn finger	872..892	CDD:275368
		zf-C2H2	872..892	CDD:306579
		zf-H2C2_2	884..909	CDD:316026
		C2H2 Zn finger	900..920	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1018..1039
drm	NP_001285590.1	C2H2 Zn finger	28..48	CDD:275368	9/22 (41%)
drm	NP_001285590.1	C2H2 Zn finger	57..77	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910