DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SALL4 and CG4854

DIOPT Version :9

Sequence 1:NP_065169.1 Gene:SALL4 / 57167 HGNCID:15924 Length:1053 Species:Homo sapiens
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:329 Identity:72/329 - (21%)
Similarity:125/329 - (37%) Gaps:89/329 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   365 NISAVDVK-------PKDEAAL-----YKHKCKYCSKVFGTDS---------SLQIHLRSHTGER 408
            |:.:.|:|       ||||:.:     :..|.|.|:.|..::|         |..:.||:....|
  Fly     4 NVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKLR 68

Human   409 PFVCSVCGHRFTTKGNLK-----------VHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVP 462
                |:|..   |:.:||           ||..:..:.|...:..:: .:...:.:.:.|     
  Fly    69 ----SLCQQ---TEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSK-NEATGSDSELEY----- 120

Human   463 DPIDEPSLSLDSKP---------VLVTTSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGG 518
            :.:|...::|:|..         |.:..::..|:......:||.:|.             |.|  
  Fly   121 EYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTF-------------EDE-- 170

Human   519 PTLPGVGPNYNSPRAGGFQGSGTPEPGSETLKL--QQLVENIDKATTDPNECLICHRVLSCQSSL 581
                      :|.:|..|..:......||.:||  ...|.:..|    |:||.|||:.......|
  Fly   171 ----------DSGQAASFTCNICNNVYSERVKLTNHMKVHSAKK----PHECEICHKRFRQTPQL 221

Human   582 KMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHIR 646
            ..|..||||.||::|..|...|:.......|..:| ||   :..:.|..|.:.|..:.:|:.|::
  Fly   222 ARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIH-TN---ERPYKCEFCSRSFGYSNVLRVHLK 282

Human   647 MHMG 650
            .|.|
  Fly   283 THTG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SALL4NP_065169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..149
zf-C2H2 382..404 CDD:306579 8/30 (27%)
C2H2 Zn finger 384..404 CDD:275368 7/28 (25%)
zf-H2C2_2 396..421 CDD:316026 6/24 (25%)
C2H2 Zn finger 412..432 CDD:275368 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..546 9/62 (15%)
C2H2 Zn finger 568..588 CDD:275368 6/19 (32%)
zf-H2C2_2 580..605 CDD:316026 11/24 (46%)
C2H2 Zn finger 596..619 CDD:275368 5/22 (23%)
zf-C2H2 626..648 CDD:306579 5/21 (24%)
C2H2 Zn finger 628..648 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 736..776
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 788..828
C2H2 Zn finger 872..892 CDD:275368
zf-C2H2 872..892 CDD:306579
zf-H2C2_2 884..909 CDD:316026
C2H2 Zn finger 900..920 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1018..1039
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 9/44 (20%)
C2H2 Zn finger 180..200 CDD:275368 4/19 (21%)
zf-H2C2_2 193..217 CDD:290200 9/27 (33%)
COG5048 201..>258 CDD:227381 20/61 (33%)
C2H2 Zn finger 208..228 CDD:275368 6/19 (32%)
zf-H2C2_2 221..244 CDD:290200 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 4/19 (21%)
zf-H2C2_2 251..273 CDD:290200 7/25 (28%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-H2C2_2 277..301 CDD:290200 4/10 (40%)
C2H2 Zn finger 292..312 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.