DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SALL4 and CG10654

DIOPT Version :9

Sequence 1:	NP_065169.1	Gene:	SALL4 / 57167	HGNCID:	15924	Length:	1053	Species:	Homo sapiens
Sequence 2:	NP_001261767.1	Gene:	CG10654 / 39428	FlyBaseID:	FBgn0036294	Length:	412	Species:	Drosophila melanogaster

Alignment Length:	81	Identity:	27/81 - (33%)
Similarity:	44/81 - (54%)	Gaps:	1/81 - (1%)

- Green bases have known domain annotations that are detailed below.

Human   567 ECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHL-GVHRTNTSIKTQHSCPI 630
            ||.||||.....|.|:.|.:.|.|.||:.|..|.::::....|::|| .:|....:.:..::||.
  Fly   227 ECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACPS 291

Human   631 CQKKFTNAVMLQQHIR 646
            |.|.:|....|:.|:|
  Fly   292 CNKVYTANRSLKYHMR 307

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SALL4	NP_065169.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..62
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..149
		zf-C2H2	382..404	CDD:306579
		C2H2 Zn finger	384..404	CDD:275368
		zf-H2C2_2	396..421	CDD:316026
		C2H2 Zn finger	412..432	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	483..546
		C2H2 Zn finger	568..588	CDD:275368	8/19 (42%)
		zf-H2C2_2	580..605	CDD:316026	8/24 (33%)
		C2H2 Zn finger	596..619	CDD:275368	6/23 (26%)
		zf-C2H2	626..648	CDD:306579	8/21 (38%)
		C2H2 Zn finger	628..648	CDD:275368	8/19 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	694..714
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	736..776
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	788..828
		C2H2 Zn finger	872..892	CDD:275368
		zf-C2H2	872..892	CDD:306579
		zf-H2C2_2	884..909	CDD:316026
		C2H2 Zn finger	900..920	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1018..1039
CG10654	NP_001261767.1	zf-AD	39..115	CDD:285071
		C2H2 Zn finger	228..248	CDD:275368	8/19 (42%)
		C2H2 Zn finger	256..313	CDD:275368	14/52 (27%)
		C2H2 Zn finger	289..314	CDD:275368	8/19 (42%)
		zf-C2H2	323..345	CDD:278523
		C2H2 Zn finger	325..345	CDD:275368
		C2H2 Zn finger	355..376	CDD:275368
		C2H2 Zn finger	385..405	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910