DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SALL4 and CG12391

DIOPT Version :9

Sequence 1:NP_065169.1 Gene:SALL4 / 57167 HGNCID:15924 Length:1053 Species:Homo sapiens
Sequence 2:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster


Alignment Length:372 Identity:83/372 - (22%)
Similarity:134/372 - (36%) Gaps:66/372 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   362 KPPNISAVDVKP-KDEAALYKHKCKYCS-----------KVFGTDSSLQIHLRSHTGERP----- 409
            :|.:::.|.::. |.|..:.:.:|:.|:           ::..|.:.:.:.:..:....|     
  Fly   218 EPGDLADVPIRERKKEEPVDEDQCRVCTSKEELVCLFKKQIDATPADMLLVICPNVSILPKDFMP 282

Human   410 -FVCSVCGHRFTTKGNLKVHFHRHPQVKANPQ----LFAEFQDKVAAGNGIPYALSVPDPIDEPS 469
             |:|:.|      .|:|.:......|::...|    ..:..::||....|  |.:     ||.| 
  Fly   283 QFICTKC------MGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRG--YVV-----IDAP- 333

Human   470 LSLDSKPVLVTTSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGV-GPNYNSPRA 533
                     ||.|......|.......|: .|:...|.....|.:||.....||. |.....|..
  Fly   334 ---------VTDSSEDEDELDDEFKVSDV-AGTTSADSDSADSDDSEKEKKKPGPRGRPRKKPLK 388

Human   534 GGFQGSGTPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGER-PFQCK 597
            .|....|  ||.|...|..|   ....|:..|.||..|....|.:.|..:|.:||  || ...|.
  Fly   389 RGTDSDG--EPSSAQKKKYQ---PSSTASVGPFECPNCDLTFSRKQSYVLHRKTH--ERIEHACP 446

Human   598 ICGRAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHI--RMHMGGQIPNTPLPE 660
            |||:.|..:...|||:..|...   :....|.:|.|.|.....|:.|:  |....|.|...    
  Fly   447 ICGKKFKVEWAYKTHMQRHEQE---RAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYEC---- 504

Human   661 NPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSK 707
            ..|..|......:..:.:.|...|.:  :|:.::|..|:....|.||
  Fly   505 KRCQRTFLTQQRLQRHQAVGCQRHKE--DSVRIKEEQSRFKQESRSK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SALL4NP_065169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..149
zf-C2H2 382..404 CDD:306579 3/32 (9%)
C2H2 Zn finger 384..404 CDD:275368 3/30 (10%)
zf-H2C2_2 396..421 CDD:316026 4/30 (13%)
C2H2 Zn finger 412..432 CDD:275368 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..546 15/63 (24%)
C2H2 Zn finger 568..588 CDD:275368 5/19 (26%)
zf-H2C2_2 580..605 CDD:316026 11/25 (44%)
C2H2 Zn finger 596..619 CDD:275368 9/22 (41%)
zf-C2H2 626..648 CDD:306579 7/23 (30%)
C2H2 Zn finger 628..648 CDD:275368 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..714 5/14 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 736..776
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 788..828
C2H2 Zn finger 872..892 CDD:275368
zf-C2H2 872..892 CDD:306579
zf-H2C2_2 884..909 CDD:316026
C2H2 Zn finger 900..920 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1018..1039
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 11/78 (14%)
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-C2H2 443..465 CDD:278523 8/21 (38%)
C2H2 Zn finger 445..465 CDD:275368 8/19 (42%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 2/20 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.