DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SALL4 and crol

DIOPT Version :9

Sequence 1:NP_065169.1 Gene:SALL4 / 57167 HGNCID:15924 Length:1053 Species:Homo sapiens
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:1062 Identity:210/1062 - (19%)
Similarity:321/1062 - (30%) Gaps:339/1062 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    88 LEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVLSHQPTSPGSKDCHRENGGSSEDMKEKPDAESV 152
            ::|....:..|.|:.      ||.:...:...|...|..|.|:  |:|:|        ||.....
  Fly     1 MQHVSAASSVPSVVT------PVVTTGGTTITLGGPPPLPKSE--HKEDG--------KPPHGIE 49

Human   153 VYLKTETALPPTPQDISYL-----AKGKVAN--TNVTLQALRGTKVAVNQRSADALPAPVPGANS 210
            :| |...      :|||.|     ..||:..  .|..|.|..|.:          ||.|.|    
  Fly    50 MY-KVNI------EDISQLFTYHEVFGKIHGDVVNHQLAAAHGGQ----------LPPPPP---- 93

Human   211 IPWVLEQILCLQQQQLQQIQLTEQIRIQVNMWASHALHSSGAGADTLKTLGSHMSQQVSAAVALL 275
                                |..|:       .|||..::.|.|         .:...:||||.:
  Fly    94 --------------------LPPQV-------TSHAASAAAAAA---------AASTNNAAVAAV 122

Human   276 SQKAGSQGLSLDALKQAKLPHANIPSATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSA------- 333
            ...|.:               |...:|.:|...||.|.|....|.:|.....|...|:       
  Fly   123 MASANA---------------AAAAAAAASAGGGLPPATSGNGGQQVTVTTTSSSTSSGGSTTSG 172

Human   334 ---------LLPQAPGSVLFQSPFSTVALDTS-KKGKGKPPNIS-AVDVKPKDEAALYKHKCKYC 387
                     |:|:..|.:        ..:|.| ..|.|...|:: |.|..|   .|...|.|..|
  Fly   173 GTTTTAGELLMPKMEGGI--------HGVDGSGNGGNGGGQNVALAPDGTP---IATGTHVCDIC 226

Human   388 SKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFTTKGNLKVHFHRHPQVKANPQLFA--------- 443
            .|:|.....|.:|.|.|:..:||:|.|||..|||..:|.    ||.::.....:|.         
  Fly   227 GKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT----RHGKIHIGGPMFTCIVCFNVFA 287

Human   444 -----------EFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVTTSVGLPQNLSSGTNPKD 497
                       ...||       |:|.::..........||:             :..|.|    
  Fly   288 NNTSLERHMKRHSTDK-------PFACTICQKTFARKEHLDN-------------HFRSHT---- 328

Human   498 LTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSGTPEPGSETLKLQQLVENIDKAT 562
               |..|...|                   |.:               ....:.:.:|.::.|.|
  Fly   329 ---GETPFRCQ-------------------YCA---------------KTFTRKEHMVNHVRKHT 356

Human   563 TD-PNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTSIK--- 623
            .: |:.|.||.:..:.:.....||..|||:.|.||.:||:.::.|.:|..|:..|...|..:   
  Fly   357 GETPHRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEI 421

Human   624 ---------------------TQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPENP--CD- 664
                                 |.|.|..|.|.||....|..|:|.|.|         |:|  |. 
  Fly   422 CGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTG---------ESPHRCSY 477

Human   665 ----FTGSEPMT------VGENGSTGAIC------HDDVIESIDVEEVSSQEAPSSSSKVPTPLP 713
                ||..|.:.      .||.......|      .|.::..:      .|....|..|......
  Fly   478 CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHV------RQHTGESPHKCTYCTK 536

Human   714 SIHSASPTLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPD 778
            :..............:.|:|.:.........|:          :.|||......||      ||.
  Fly   537 TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRK----------EHLTNHVRLHTGD------SPH 585

Human   779 ILE--TTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVEV 841
            ..|  ..:|......|:......|.:|...:........:..:....|...|..|          
  Fly   586 KCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDR---------- 640

Human   842 PGTFVGPSTLSPGMTPLLAAQ-----PRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVCN 901
            |.|........|....||..|     .:...:...|.:|.|||.....|..|.|:|:||||..|.
  Fly   641 PFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACT 705

Human   902 ICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP-SVNVD 965
            :|.:||..:||||.|                :.:.:..|::...........|..:|.. ...|.
  Fly   706 LCSKAFVERGNLKRH----------------MKMNHPDAMMPPPPVHPHPQIPAGVLTQVKQEVK 754

Human   966 PVVWNQYTSMLNGGLAVKTNEISVIQ------SGGVPTLPVSLG------ATSVVNNATVSKMDG 1018
            |::...:::         |..:..||      :||...:.::.|      :|.:.:||...:...
  Fly   755 PIIIPHHSA---------TTTMHTIQQITAGAAGGAGAVQLTPGLVPLVTSTLISHNAAAQQQSQ 810

Human  1019 SQSGISADVEKPSATDGVPKHQ 1040
            .|...:|...:..|.......|
  Fly   811 KQQAAAAAAAQQQAAAAAAAQQ 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SALL4NP_065169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..149 9/32 (28%)
zf-C2H2 382..404 CDD:306579 8/21 (38%)
C2H2 Zn finger 384..404 CDD:275368 7/19 (37%)
zf-H2C2_2 396..421 CDD:316026 11/24 (46%)
C2H2 Zn finger 412..432 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..546 6/62 (10%)
C2H2 Zn finger 568..588 CDD:275368 5/19 (26%)
zf-H2C2_2 580..605 CDD:316026 10/24 (42%)
C2H2 Zn finger 596..619 CDD:275368 7/22 (32%)
zf-C2H2 626..648 CDD:306579 9/21 (43%)
C2H2 Zn finger 628..648 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..714 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 736..776 6/39 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 788..828 4/39 (10%)
C2H2 Zn finger 872..892 CDD:275368 8/19 (42%)
zf-C2H2 872..892 CDD:306579 8/19 (42%)
zf-H2C2_2 884..909 CDD:316026 12/24 (50%)
C2H2 Zn finger 900..920 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1018..1039 3/20 (15%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 7/19 (37%)
C2H2 Zn finger 251..271 CDD:275368 10/23 (43%)
C2H2 Zn finger 279..299 CDD:275368 0/19 (0%)
COG5048 300..723 CDD:227381 105/540 (19%)
C2H2 Zn finger 307..327 CDD:275368 2/32 (6%)
C2H2 Zn finger 335..355 CDD:275368 3/53 (6%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
C2H2 Zn finger 419..439 CDD:275368 0/19 (0%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)
C2H2 Zn finger 475..495 CDD:275368 4/19 (21%)
C2H2 Zn finger 503..523 CDD:275368 2/25 (8%)
C2H2 Zn finger 531..551 CDD:275368 0/19 (0%)
C2H2 Zn finger 559..579 CDD:275368 4/29 (14%)
C2H2 Zn finger 587..607 CDD:275368 3/19 (16%)
C2H2 Zn finger 615..636 CDD:275368 1/20 (5%)
C2H2 Zn finger 644..664 CDD:275368 4/19 (21%)
C2H2 Zn finger 676..696 CDD:275368 8/19 (42%)
C2H2 Zn finger 704..722 CDD:275368 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.