DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: jdp2a and kay

Sequence 1:XP_005158991.1 Gene:jdp2a ZFINID:ZDB-GENE-131127-459 Length:199 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:78 Identity:33/79 (42%)
Similarity:51/79 (65%) Gaps:1/79 (1%)


Zfish   106 EEEERRKRRREKNKVAAARCRNKKKERTEYLQKESERLEMMNSELKAQIEELKHERQQLILMLNR 170
            |||::|..|||:||.||||||.::.::|..|.:|.|:||.....::.:||.|.:.:.||..:|..
  Fly   416 EEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLAT 480

Zfish   171 HRPTC-IVRTDSI 182
            ||.|| .:|:|.:
  Fly   481 HRATCQKIRSDML 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
jdp2aXP_005158991.1 bZIP_ATF3 120..171 CDD:269870 18/51 (35%)
coiled coil 120..168 CDD:269870 17/48 (35%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 24/61 (39%)
coiled coil 421..480 CDD:269869 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.