DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha3T

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_651843.1 Gene:Prosalpha3T / 43679 FlyBaseID:FBgn0261395 Length:251 Species:Drosophila melanogaster


Alignment Length:248 Identity:81/248 - (32%)
Similarity:127/248 - (51%) Gaps:28/248 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPS-SIEKIVEID 71
            :|.....|||||||:|||||:||.....|.:|:....||.||.|:.: ..||:.| .:.:|..::
  Fly     5 FDSRTTIFSPEGRLYQVEYAMEAASQSGTCVGLLAKNGVLLATERSV-DKLMDTSIPVPRISWLN 68

Human    72 AHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA------LQFGEEDADP 130
            .:|.|..:|..||...|:::.|:..|.:.|.:.|.:..|   |.|:||.      .|:|.:    
  Fly    69 ENIACCATGNTADGNVLVNQLRMIAQQYQFNFGEMIPCE---QLVTNLCDIKQAYTQYGGK---- 126

Human   131 GAMSRPFGVALLFGGVDEK-GPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQ-EVYHK---SMT 190
                |||||:.|:.|.|.: |.||:..||||.:....|..||..|..|...|| |::.|   |.:
  Fly   127 ----RPFGVSFLYMGWDCRFGFQLYQSDPSGNYSGWKATCIGRKSGAAMEMLQKELFSKGYVSPS 187

Human   191 LKEAIKSSLIILKQVM-EEKLNATNIELATVQPGQN---FHMFTKEELEEVIK 239
            ::||...::.::...: .:.|....:|:|.||...|   ||:..|.|:..:|:
  Fly   188 VEEAKDVAIKVMGMTLGRDSLTPEKLEIAFVQRYGNTTVFHILEKNEIHRLIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 73/224 (33%)
Prosalpha3TNP_651843.1 PTZ00246 1..241 CDD:173491 81/248 (33%)
Ntn_hydrolase 3..218 CDD:294319 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.