DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:237 Identity:80/237 - (33%)
Similarity:136/237 - (57%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI 70
            |.|.|.:..|||:|.|.|||||.||::.||||:|::.:..|.|.|||...|.:.|..::.||..:
  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67

Human    71 DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSR 135
            |.|:..|.:||.|||:.||::.:||.|:|...:...:|:|.:|:.::.|..::.:.:.     .|
  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNG-----RR 127

Human   136 PFGVALLFGGVDEKG-PQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVY--HKSMTLKEAIKS 197
            |||::.|.||:|..| .:|||.:|||.|.:..|.|.|..:...:...::.|  |:..|..:|||.
  Fly   128 PFGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKL 192

Human   198 SLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIK 239
            ::..|.:|.:  ::...:|:|.::.|:...|.....:.|::|
  Fly   193 AMRALLEVTQ--MSQMRLEVAVLENGKPMKMLDSVVISEIVK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 75/214 (35%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 79/235 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 75/214 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.