DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:172 Identity:43/172 - (25%)
Similarity:80/172 - (46%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    34 GSTAIGIQTSEGVCLAVEKRITSPL-MEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQ 97
            |.:.:.|...:...:|.:.|::|.. :...:..|:.::........:|..||..:|....:|..|
  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93

Human    98 NHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSR---PFGVALLFGGVDEKGP-QLFHMDP 158
            ::..|:..|||.|:|.|.:| :|:           .:|   |:.|:.:..|:|.:|. .::..||
  Fly    94 SYEHTHLRTMTTEAVAQMLS-IAM-----------YNRRFFPYYVSNILAGIDNEGKGVVYSYDP 146

Human   159 SGTFVQCDARAIGSASEGAQSSL-QEVYHKSMTLKEAIKSSL 199
            .|...:...||.|:|....|..| .::.||:|.|::|.|..|
  Fly   147 IGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 43/172 (25%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 43/172 (25%)
PRE1 24..225 CDD:223711 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.