DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha3

DIOPT Version :8

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster

Alignment Length:250 Identity:89/250 (36%)
Similarity:137/250 (55%) Gaps:31/250 (12%)


Human     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME---PSSIEKIVE 69
            ||.....|||||||:|||||:|||....|.:||...:|:.||.|.|.|:.|::   ||  |||..
  Fly     5 YDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPS--EKIYR 67

Human    70 IDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA------LQFGEEDA 128
            ::.::.|:::|:.:||..|..:.|:..|.:.|:|.|.:..|   |.||:|.      .|:|.:  
  Fly    68 LNDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCE---QLVSHLCDIKQAYTQYGGK-- 127

Human   129 DPGAMSRPFGVALLFGGVDEK-GPQLFHMDPSGTFVQCDARAIGSASEGAQSSL-QEVYHK---S 188
                  |||||:||:.|.|.| |.||:..||||.:....|..||:....|.|.| ||:..|   .
  Fly   128 ------RPFGVSLLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVK 186

Human   189 MTLKEAIKSSLIILKQVME-EKLNATNIELATVQPGQN---FHMFTKEELEEVIK 239
            :||.:|...::.:|...:: .||....:|:||:|...|   :.:..|.::|::|:
  Fly   187 LTLADAKDLAIKVLSMTLDTTKLTPEKVEMATLQRVDNKTVYSVLEKPDVEKLIE 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 84/227 (37%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 89/250 (36%)
proteasome_alpha_type_4 3..219 CDD:239721 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.