DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha5

DIOPT Version :8

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster

Alignment Length:243 Identity:172/244 (70%)
Similarity:204/244 (84%) Gaps:2/244 (1%)


Human     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65
            ||||||||||||||||||||||||||||||||||||||||.|.|||.||||||||||||.||::|
  Fly     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVE 65

Human    66 KIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEE-DAD 129
            ||||:|.|||||.|||:|||:|||::||||.|||||.|||.|::||..||||.||:|||:. |:|
  Fly    66 KIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSD 130

Human   130 -PGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKE 193
             ..|||||||||:||.|::...|||:|||||||||:..|:||||.|||||.:||:::...:||.|
  Fly   131 GAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDE 195

Human   194 AIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI 241
            ||..||..||||||||||:||:|:.|:...:.|:||||||:|:.||:|
  Fly   196 AIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 154/214 (72%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 164/235 (70%)
proteasome_alpha_type_5 8..222 CDD:239722 154/214 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221934987
eggNOG 1 0.900 E1_COG0638
Hieranoid 1 1.000
Homologene 1 1.000 H2084
Inparanoid 1 1.050 336 1.000 Inparanoid score I2363
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 1 1.000 FOG0004347
OrthoInspector 1 1.000 T1073423
orthoMCL 1 0.900 OOG5_127593
Panther 1 1.100 LDO PTHR11599
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1007
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.