DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSMA5 and Prosalpha6T

DIOPT Version :8

Sequence 1:NP_002781.2 Gene:PSMA5 / 5686 HGNCID:9534 Length:241 Species:Homo sapiens
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster

Alignment Length:249 Identity:82/250 (33%)
Similarity:137/250 (55%) Gaps:26/250 (10%)


Human     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65
            ||  |::||....|:||:|||||||||:||:|.|:..:|::.::...||...|.:.   :.::::
  Fly     1 MF--RNQYDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSK---DTNTLQ 60

Human    66 -KIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA--LQFGEED 127
             ||:.:|.|:|.:::||.|||:.:....|.|...:..:||....|.   :.||||.  ||...:.
  Fly    61 RKIMPVDDHVGMSIAGLTADARVVCQYMRTECMAYRHSYNAEFPVR---RLVSNLGNKLQTTTQR 122

Human   128 ADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK 192
            .|    .||:||.||..|.||:||.::.:.|:...:.|.|.||||.|:.|::.|:    ::|...
  Fly   123 YD----RRPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLE----RNMESF 179

Human   193 EAIKSSLIILK--QVMEEKLNATNIELATVQ---PGQN--FHMFTKEELEEVIK 239
            |......:|..  |.:...|.:.::|..|:.   .|::  |.|||:.|.::.:|
  Fly   180 EDCDMDELICHAIQAIRGSLGSDDVENLTINVAIVGKDVPFKMFTEAENQKYVK 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PSMA5NP_002781.2 proteasome_alpha_type_5 8..220 CDD:239722 72/217 (33%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 78/243 (32%)
proteasome_alpha_type_1 6..215 CDD:239718 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.