DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atp8b3 and CG33298

Sequence 1:XP_003201102.2 Gene:atp8b3 ZFINID:ZDB-GENE-050208-424 Length:1174 Species:Danio rerio
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1307 Identity:392/1308 (30%)
Similarity:605/1308 (46%) Gaps:266/1308 (20%)


Zfish    56 GRYADNVVRSYKYTPLTFFPLNLYEQFQRAANLFFLLIVILQCVPVIATIPWYTTMLPLLIVLFV 120
            |::..|.:|:.|||.|:|.|.||.|||.|.|||:|:.||:|..||.|:.......|:|:|.||.|
  Fly   248 GQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGV 312

Zfish   121 RGCKDLATDVGRRRSDAQINRRPCDIL--TPEGFKTVKWKDVCVGDILRVHKDQVIPADLLLLCS 183
            ...|||..|..||.||.:||...|.:.  ..|.:|.|||:::.||||:.:..::.:|||:|||.:
  Fly   313 TAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRT 377

Zfish   184 TEPYSLCYVETADIDGETNLKFRQALTVTHTELNGDSTEQNL---AAFDAIVRCEEPNGNLHSFR 245
            ::|..:||::|.|:|||||||.|:.       :.|....|::   :.|.:.|..:.|...|:.|.
  Fly   378 SDPQGVCYIDTCDLDGETNLKRREV-------VRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFH 435

Zfish   246 GE-FHWKGERHLLGTDHLLLRGTVLRNTDYAYGLTIYTGSDSKILQNCGRLKLKKTHVEILLNKT 309
            |. .|..|||..:.|:.||||.:.|:||||..|:.:|.|.::|.:.|....:.|::.||..:|..
  Fly   436 GALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNID 500

Zfish   310 VLVILLFMLTTALLLAIGAGIFEYRISPNYDVVSIVQRDSSPAYQGFLTFWGYIILLSPSMPMSL 374
            |:..::.:|...::.|||..::....: ::.|..:.....:...:....||.||::|...:|:||
  Fly   501 VIWCVIILLILCVVGAIGCRMWLSSFT-HFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSL 564

Zfish   375 YITFEVIHMVHCLLIGWDVEMYWEDTNCPAHARTTTLNEELGQVGHLLSDKTGTLTQNRLLFRQC 439
            |:|.|:..::....|..:|:::..:||.....|...:.|||||:.|:.:|||||||:|:::||:|
  Fly   565 YVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRC 629

Zfish   440 FIAGHIYGDISQK-----SKP------------LDLSWNRFSCGG-LKFSDQRLVDKLRGRGSLE 486
            .:.|..|.....:     |||            |:....:.:.|. |....||:           
  Fly   630 VVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRI----------- 683

Zfish   487 CQEFFTALALCHTVM-------------------------------------------------- 501
             |||...||:|:||:                                                  
  Fly   684 -QEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTI 747

Zfish   502 ------------------------------------------------------------SEWK- 505
                                                                        ||.: 
  Fly   748 INGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESES 812

Zfish   506 ----------------------------------------------------------DGLPHYQ 512
                                                                      ||.|.|:
  Fly   813 PSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYE 877

Zfish   513 AASPDEEALVCAARELGWVFLSRTRDTLTIS--EMGLTRNYQLLALLDFTSKRRRMSVLVRSPGG 575
            |.||||.|||.||.......|:|:.:.:.:|  ..|.||.|::|.:|.|.|.|:.||::||..|.
  Fly   878 AESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGS 942

Zfish   576 Q-LKLYSKGADIVILERL------QKDWPLQESTDRALELFAQSCLRTLCVAVRPVPEALWTEWS 633
            | :.||:||||..|:..|      ..:..|:|.|.:.|:.:|:..||.|.:|.|.:..|.:|:|.
  Fly   943 QEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWW 1007

Zfish   634 RALNLAGTATGNQETLLEEIYDQMEKDLMLLGVTAIEDRLQEGVPETIASLRRAGVKVWVLTGDK 698
            ........:..|:|..|.:.:.::|.:|.|||.|.||||||:|||||||||..||:.||||||||
  Fly  1008 ARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDK 1072

Zfish   699 TETAVNVGYACKLMDPDTTLIQGEELRQLLESPSSNVDVKSKEPEVWITD--------------- 748
            .|||:|:.|:.||.         .:..:|:...:.:.|........::||               
  Fly  1073 PETAINIAYSAKLF---------TQQMELIRLTARSRDAAETAINFYLTDMENDKTTSTLGYGQS 1128

Zfish   749 --KKAVMSKAALVISGPELA-ELTKSSEWGAKFVALSGQCQSVLCCRVTPAQKAEVVEMVRKHSA 810
              ||    :.|||:.|..|. .|...|:....|:.||.:|.||||||.||.|||.:|::|::...
  Fly  1129 LRKK----QRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELN 1189

Zfish   811 SITMAIGDGANDVNMIKTAHIGVGLCGVEGSQAVLNADFALAQFSFLRKLLLVHGHWSYYRISIL 875
            ..|:|||||||||:||:.|.:|||:.|.||.|||:.|||.|.:|.:|.:|||.||:|.|.|:|.:
  Fly  1190 LRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRM 1254

Zfish   876 LRYFLYKTTAFALVHTWYSFYNGFSAQPMYESWYISLFTTTYTSLPIQCTGIFEQDISARSCLCW 940
            :.||.||..||..:..||..|.|||.|.|.:..|:.|:...:||||....|::::.::....|..
  Fly  1255 ILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKN 1319

Zfish   941 PEIYSIGQKKQLFNPSVLASTLLYSFYSSIIFFFVPMGILQYSALDFQTLAITIETSVLFATTLE 1005
            |.:|..|:....:.|......||.:.|.|::.|||.:.....|.:.......||..|.|||..:.
  Fly  1320 PYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVH 1384

Zfish  1006 VILCTKYWTKWNVAAVIFSLAAFFLSTLALHSTRLFTASPK-DYFFLGASQNAYSTPEVWLTIFV 1069
            ..:..:.||..:|.:::.||.:|:|..:...|..:.....: .|:.:..   .:::...||.|.:
  Fly  1385 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFV---CFASAVHWLVIML 1446

Zfish  1070 TTCVAVLPSITTRALGVVLANPNKHKI------HSSANEPVELQSWFQRGTVQRRSSYAVSQGKG 1128
            :|.|||||.:....:.:.|...:..|:      ..|..|.: |.:| .|.| ...|.|.::....
  Fly  1447 STVVAVLPRLLLTTVRISLCPDDSTKVILQSKRERSRGEAL-LVTW-SRST-SASSIYRITDYGS 1508

Zfish  1129 FGKLITT 1135
            ..::|||
  Fly  1509 KNQIITT 1515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atp8b3XP_003201102.2 PhoLip_ATPase_N 52..109 CDD:292826 25/53 (47%)
ATPase-Plipid 58..1096 CDD:273734 380/1259 (30%)
Cation_ATPase <515..591 CDD:289987 34/79 (43%)
R3H 650..706 CDD:294210 36/56 (64%)
HAD_like <813..837 CDD:304363 16/24 (67%)
PhoLip_ATPase_C 844..1084 CDD:292829 74/241 (31%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 380/1259 (30%)
E1-E2_ATPase 302..>394 CDD:278548 39/92 (42%)
Cation_ATPase <880..965 CDD:289987 35/85 (41%)
HAD_like <1177..1240 CDD:304363 33/63 (52%)
PhoLip_ATPase_C 1223..1468 CDD:292829 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.