DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MASP1 and CG11670

Sequence 1:XP_011511291.1 Gene:MASP1 HGNCID:6901 Length:735 Species:Homo sapiens
Sequence 2:NP_001097767.2 Gene:CG11670 FlyBaseID:FBgn0038114 Length:404 Species:Drosophila melanogaster

Alignment Length:294 Identity:82/295 (28%)
Similarity:132/295 (45%) Gaps:65/295 (22%)


Human   460 GRN-AEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHV 523
            ||: ..||.:|..|.:...:.:...:.|.  .|:|:|..::|||||.|.:......::.:.    
  Fly   145 GRSIVAPGQYPHMAALGFRNENHEIDYKC--GGSLISEEFVLTAAHCLTTHGTSPDIVKIG---- 203

Human   524 TVYLGLHDVRDKSGAVNSS-----AARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPR 583
                   |::.|...:|.:     .|::.|||.:|.....|||.|:||..||.....|.||   |
  Fly   204 -------DIKLKEWELNVAPQRRRVAQIYLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPV---R 258

Human   584 LEPEGPAP----HMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESR 644
            |.|....|    |.:| ....|.:.|.              :::|..:.|.|||..:|.:|..:.
  Fly   259 LWPMNDIPYGKLHTMG-YGSTGFAQPQ--------------TNILTELDLSVVPIEQCNSSLPAD 308

Human   645 SGN-YSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQ-----------RWVVQGLVSWGGPE 697
            .|: :.:..:..||..||..:|||.|||||...:  :|.:           |:.:.|:.|:|.  
  Fly   309 EGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQL--NLERRRRRHTSRKHYRYYLVGITSYGA-- 369

Human   698 ECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEP 731
            .|.| ::.||||:||:|:||:       .|:|.|
  Fly   370 YCRS-ELPGVYTRVSSYIDWI-------ASIVWP 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056
Tryp_SPc 456..718 CDD:214473 79/280 (28%)
Tryp_SPc 457..718 CDD:238113 79/280 (28%)
CG11670NP_001097767.2 Tryp_SPc 145..392 CDD:238113 80/290 (28%)
Tryp_SPc 145..389 CDD:214473 79/280 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.