DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: si:ch211-153j24.3 and kay

Sequence 1:XP_692833.6 Gene:si:ch211-153j24.3 ZFINID:ZDB-GENE-041014-38 Length:329 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:265 Identity:71/266 (27%)
Similarity:119/266 (45%) Gaps:20/266 (8%)


Zfish    55 STDISSVSPCRQQKTQSSSHSTDAKAARKTFTGRRKGAKDQLSPEEEERKRIRRERNKLAAAKCR 119
            |..:::||..|...:..||::..:....:...|||......::||||:::.:||||||.|||:||
  Fly   372 SNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCR 436

Zfish   120 NRRRDLTNSLQAETDGLEEDKAALQSEIASLLKEKERLELILSAHKPHCK------LTEETENEE 178
            .||.|.||.|..|.:.||:...:::.||..|...|.:||.:|:.|:..|:      |:..|.|..
  Fly   437 KRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGL 501

Zfish   179 PAPAQEEKTQAASVPEQVPASPPQADPTSAAIFGDSDVLLCSSAELGAAEVEPYIDMRDVCM--- 240
            .|||......::........:....|.::..|.|....|..:.......:::|..::..:.|   
  Fly   502 IAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIK 566

Zfish   241 -EDISSVIDSGDDMD---------LLVPDIDLSSSLGLSEWETLYMSMGGGLE-PLSSPTCSPST 294
             |.:...||||..:|         :.:|.:.....:.||...|...:..|.|: |::|.......
  Fly   567 DEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILTPTGASSGSLQTPITSTAPGGFG 631

Zfish   295 DAVPV 299
            .|.||
  Fly   632 SAFPV 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
si:ch211-153j24.3XP_692833.6 bZIP_Fos 111..164 CDD:269869 23/53 (43%)
coiled coil 111..163 CDD:269869 23/52 (44%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 27/61 (44%)
coiled coil 421..480 CDD:269869 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 1 1.000 T596392
orthoMCL 1 0.900 OOG5_146479
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.