DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: slc2a6 and CG33282

Sequence 1:XP_689092.6 Gene:slc2a6 ZFINID:ZDB-GENE-081104-301 Length:490 Species:Danio rerio
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:482 Identity:112/483 (23%)
Similarity:216/483 (45%) Gaps:39/483 (8%)


Zfish     8 ATPLINNSPPRISHGKLYLAVFSAVLGNFNFGFALVFPSPVIPQLKQGDD-TRLQMNVHQISWFG 71
            ||.|.|:...:.:..:|...|...:: .|..|..:.:.||.:.:::..|. ...::|:.||||.|
  Fly     2 ATFLKNSLLQQKTRYQLLATVIVNII-TFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLG 65

Zfish    72 SIFTLGAAAGGLSAMFLNDRVGRKISIMISGLPSVLGLLVMGSAQNFWMLLWGRFLTGIAGGITA 136
            |:..|.:..|.|:...|.:|.|||..:.:...|.....:::..|.|.:.|...|||.|..||...
  Fly    66 SMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGY 130

Zfish   137 GSIPVYVSEISHPSVRGALGSCPQITAVFGSLALYAFGLILPWR---WLAVAGEVPVVIMMLLLC 198
            ..:|:::||::..::||||.|...::...|.||.|.....|.:.   :||:...|...|..::| 
  Fly   131 LVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIML- 194

Zfish   199 CMPTSPRYHIMKGNRAKAVKSLEWLRGPNSDYMTE-----FNKIERSITTQ------GVQWSDLK 252
              |.:..|.:.|...|.|..|..:.|...|....:     |.::..::.:|      .:.:.||.
  Fly   195 --PETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLT 257

Zfish   253 TKSYYKPILISVVMRFLQQMTGITPILVYLEPIFHLTAISLEPKYDAALVGAVRLISVAIAASLM 317
            ||...|....|:|:....|.:|:...:.|:..||..:...::......::|.|:::.|..:..|:
  Fly   258 TKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILV 322

Zfish   318 DKAGRKALLFTSGFLIYIAMLSMTMYTHQTPCSQGNLTLTDGLNISSEVQAGAAFDPKTLIPLIS 382
            |..||:.|:..|...:.|..::...:|:          |....::|.       |:   .:||:.
  Fly   323 DIVGRRVLMLISTMGVGIGCIAFGCFTY----------LAKIYDLSD-------FN---WLPLVL 367

Zfish   383 AMVIIFGYAMGWGPITWLLMSEILPLGARGVASGLCVGVSWITAFVLTQLFMHVVVAYGLYVPFL 447
            .::|.:...:|...|.:|::.|:.|:..|.:|:.|.|....:..|...:||..::..:|:.....
  Fly   368 MIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMW 432

Zfish   448 FFCVVSVVNIIFTAKCVPETKGRTLEE 474
            |....:::...:....:.||||:::.|
  Fly   433 FSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
slc2a6XP_689092.6 Sugar_tr 27..479 CDD:278511 107/464 (23%)
MFS 28..461 CDD:119392 102/448 (23%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 102/451 (23%)
MFS_1 53..409 CDD:284993 91/379 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97366223
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23500
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.