DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Slc2a8 and CG33282

Sequence 1:NP_062361.1 Gene:Slc2a8 MGIID:1860103 Length:477 Species:Mus musculus
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:465 Identity:122/466 (26%)
Similarity:208/466 (45%) Gaps:43/466 (9%)


Mouse    24 RRVFLASFAAALGPLSFGFALGYSSPAIPSLRRTAPPALRLGDNAA--SWFGAVVTLGAAAGGIL 86
            |...||:....:.....|..:|:.||.:..: :||...|....|.|  ||.|:::.|.:..|.:.
  Fly    15 RYQLLATVIVNIITFGHGVGVGWLSPTLTKI-QTADSPLDFEVNLAQISWLGSMLGLDSLCGNLT 78

Mouse    87 GGWLLDRAGRKLSLLLCTVPFVTGFAVITAARDVWMLLGGRLLTGLACGVASLVAPVYISEIAYP 151
            ...|::|||||..|.|...|:...:.:|..|.:|:.|...|.|.|...|...||.|::|||:|..
  Fly    79 IAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADS 143

Mouse   152 AVRGLLGSCVQLMVVTGILLAYVAGWVLEWRWLAVLGCVPPTLMLLLMCYMPETPRFLLTQHQYQ 216
            .:||.|.|.|.|.|..|||..|:....|.:..:..|..:.|....:....:|||..:||.:.|..
  Fly   144 NIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLA 208

Mouse   217 EAMAALRFLWGSEEGWEEPPVGAEHQGFQLALLRR------PGIY-----KPLIIG----ISLMV 266
            .|..:.|:.........|.......:..:.|:|.:      |..|     ||.:.|    |.|.:
  Fly   209 AAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSL 273

Mouse   267 FQQLSGVNAIMFYANSIFE-EAKFKDSSLASVTVGIIQVLFTAVAALIMDRAGRRLLLALSGVIM 330
            ..|.|||.:.:.|.:.||: .....|.:.|::.:|::|::....:.:::|..|||:|:.:|.:.:
  Fly   274 GYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGV 338

Mouse   331 VFSMSAFGTYFKLTQSLPSNSSHVGLVPIAAEPVDVQVGLAWLAVGSMCLFIAGFAVGWGPIPWL 395
            .....|||.:..|                 |:..|:. ...||.:..|.:......:|...|.:|
  Fly   339 GIGCIAFGCFTYL-----------------AKIYDLS-DFNWLPLVLMIIICYVANIGLIGIFFL 385

Mouse   396 LMSEIFPLHVKGVATGICVLTNWFMAFLVTKEFSSVMEMLRPYG---AFWLTAAFCALSVLFTLT 457
            ::.|:||:.::.:||.:.|:   |::.||.........||..:|   ..|.:||...|:..:...
  Fly   386 VLVELFPVKIRSLATSLSVI---FLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWL 447

Mouse   458 VVPETKGRTL 467
            .:.||||:::
  Fly   448 FLQETKGKSM 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slc2a8NP_062361.1 Dileucine internalization motif. {ECO:0000255} 12..13
Sugar_tr 29..474 CDD:278511 120/461 (26%)
MFS 31..459 CDD:119392 115/449 (26%)
Monosaccharide binding. {ECO:0000250} 268..274 4/6 (67%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 115/449 (26%)
MFS_1 53..409 CDD:284993 99/377 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97525124
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000041
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23500
Phylome 1 0.910 0.694 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.