DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZMAT5 and snRNP-U1-C

DIOPT Version :9

Sequence 1:NP_001003692.1 Gene:ZMAT5 / 55954 HGNCID:28046 Length:170 Species:Homo sapiens
Sequence 2:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:53/170 - (31%) Gaps:80/170 - (47%)


- Green bases have known domain annotations that are detailed below.


Human     4 RYFCDYCDRSF-QDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCD 67
            :|:|||||... .|:...||.|..|.:|           ||                        
  Fly     3 KYYCDYCDTYLTHDSPSVRKTHCTGRKH-----------RD------------------------ 32

Human    68 FGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSS--RAE 130
               |.:|                                  :.:.|:|::|:.|..|.::  :|.
  Fly    33 ---NVKF----------------------------------YYQKWMEEQAQHLIDATTAAFKAG 60

Human   131 PIRTTVFQ-YPVGWPP----VQELPPSLRAPPPGGWPLQP 165
            .|....|. .|.|.||    |...||::.|||..|.|..|
  Fly    61 KITNNPFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZMAT5NP_001003692.1 zf-U1 4..>46 CDD:389966 14/42 (33%)
zf-CCCH 55..76 CDD:395517 2/20 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..170 8/16 (50%)
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 16/106 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.