DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZMAT5 and CG31922

Sequence 1:NP_001003692.1 Gene:ZMAT5 HGNCID:28046 Length:170 Species:Homo sapiens
Sequence 2:NP_722687.1 Gene:CG31922 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster

Alignment Length:181 Identity:47/182 (26%)
Similarity:74/182 (41%) Gaps:56/182 (31%)


Human     2 GKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQC 66
            ||.|:||||....:::|:.||.|..|:.|..||..:...:.|...||.:|:.|.||::: ....|
  Fly     3 GKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRY-FGSYC 66

Human    67 DFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEP 131
            .|.:.|:|:|.|..:|:|                         ||..:..|.||.|...:::.: 
  Fly    67 KFETYCKFTHYSGDNLRE-------------------------LEKLVLARKKRKSRKKTNKCK- 105

Human   132 IRTTVFQYPVGWP----PVQELPPSLRAPPPGGWPLQP--------RVQWG 170
                      .||    ..:.|||||:       |:.|        .:.||
  Fly   106 ----------RWPWKTHLRKGLPPSLQ-------PINPEKLKQTDFELSWG 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZMAT5NP_001003692.1 zf-U1 4..>46 CDD:328948 14/42 (33%)
zf-CCCH 55..76 CDD:279036 6/21 (29%)
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/36 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189251519
eggNOG 1 0.900 E1_COG5136
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5255
Isobase 1 0.950 0 Normalized mean entropy S7282
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1541869at2759
OrthoFinder 1 1.000 FOG0007737
OrthoInspector 1 1.000 T1073244
orthoMCL 1 0.900 OOG5_134215
Panther 1 1.100 LDO PTHR16465
Phylome 1 0.910 0.947 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5190
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.