DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK3 and Erk7

DIOPT Version :9

Sequence 1:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens
Sequence 2:NP_001188568.1 Gene:Erk7 / 31877 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster


Alignment Length:390 Identity:135/390 - (34%)
Similarity:199/390 - (51%) Gaps:89/390 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    27 EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKI-SPFEHQTYCQRTLREIQ 90
            |::......|||..|      :|:||||:|..|.|...|..||:||: ..|..:|..|||.||:.
  Fly    16 ELDQTVESIFDVRKR------MGKGAYGIVWKATDRRTKNTVALKKVFDAFRDETDAQRTYREVI 74

Human    91 ILLRFR-HENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSND-HICYFLYQILRG 153
            .|..|| |.|::.:.||.:||.   ..|.|:|.:.||:||:.::|...:..| |..:.:||::..
  Fly    75 FLRAFRCHPNIVRLVDIFKASN---NLDFYLVFEFMESDLHNVIKRGNVLKDVHKRFVMYQLINA 136

Human   154 LKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIA-------DPEHDHTGFLTEYVATRWYR 211
            :|:|||.||:||||||||:||::.|.||:.||||||..       |.|.|  |.||:||||||||
  Fly   137 IKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQD--GMLTDYVATRWYR 199

Human   212 APEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMK 276
            ||||::.|:.|||.||:|.:||||.||:..:|:|.|...::|:..|                   
  Fly   200 APEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI------------------- 245

Human   277 ARNYLQSLPSKTKVAWAKLFPKSDS------------------------KALDLLDRMLTFNPNK 317
                :.|||:.||:..|.:.|...|                        ..:.|:..:|..||:.
  Fly   246 ----VTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHN 306

Human   318 RITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLP-------------KERLKELIFQETA 369
            |:|.:||:.|||:.::...:.|        ..:.:|.:|             :..|.|||.:||:
  Fly   307 RLTAKEAIRHPYVSRFQYASAE--------MDLHMDVVPPLKDHVRYDVDQYRNSLYELIDRETS 363

Human   370  369
              Fly   364  363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_ERK1_2_like 36..370 CDD:270839 134/381 (35%)
TXY 202..204 1/1 (100%)
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 130/382 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.