DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atp8b4 and CG33298

Sequence 1:XP_687715.4 Gene:atp8b4 ZFINID:ZDB-GENE-121116-7 Length:1214 Species:Danio rerio
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1377 Identity:430/1378 (31%)
Similarity:658/1378 (48%) Gaps:275/1378 (20%)


Zfish     8 ETLRTRRR-----WPGVMAIWKKDVHIE-------EERHVR-----------ANDRDY-NERFSY 48
            |::.|.||     |      ||:.....       |||..|           ...||: |.:|  
  Fly   194 ESIYTLRRTEAPPW------WKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQF-- 250

Zfish    49 ADNRIKTAKYNVFTFLPINLFEQFQRFANAYFLVLLILQLIPEISSLSWFTTIVPLVLVLAITAV 113
            ..|:|:|.||.:.:|:|.||.|||.|.||.||:.:::|..:||||:......::|::.||.:|||
  Fly   251 VGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAV 315

Zfish   114 KDATDDYFRHKSDQQVNTRQSQVLIKG---KLQNEKWMNVRVGDVIKLENNQFVAADLLLLSSSE 175
            ||..:|..|..||:::|....:| ..|   :.:..||..:||||::.|.||:.|.||:|||.:|:
  Fly   316 KDLFEDRRRRASDKRINNTTCRV-YDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSD 379

Zfish   176 PYGLCYIETAELDGETNLKVRQALTVTSDLGDDVAKLADFNGEVICEPPNNKLDKFIGTL-YWKD 239
            |.|:|||:|.:||||||||.|:.:....:: ..:...:.|...|..:.|..||.:|.|.| :...
  Fly   380 PQGVCYIDTCDLDGETNLKRREVVRGFEEM-QSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTG 443

Zfish   240 NKYPLDNEKMLLRGCVLRNTEWCFGLVIFAGLQTKLMQNCGRTKFKRTSIDKLMNTLVLWIFGFL 304
            .:.|:..|.:|||...|:||::..|:|::||.:||.|.|....::||:.:::.||..|:|....|
  Fly   444 ERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIIL 508

Zfish   305 ICMGIILAIGNTIWEQSVGSDFWAYLQWKELTVNAVFSGFLTFWSYIIILNTVVPISLYVSVEVL 369
            :.:.::.|||..:|..|.......||...:||.|  ......||:||:||..::|:||||::|:.
  Fly   509 LILCVVGAIGCRMWLSSFTHFPVPYLPPNKLTAN--MESMWIFWTYIVILQVMIPLSLYVTIELC 571

Zfish   370 RLGHSYFINWDRRMYYSRKDTPAEARTTTLNEELGQVEFIFSDKTGTLTQNIMVFNKCSINGKTY 434
            ::...:.|:.:..::.:..:...|.|...:.|||||::.||:|||||||:|.|:|.:|.:||..|
  Fly   572 KILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDY 636

Zfish   435 GDVFDEFGHKVDITEKTPCVDFSFNPLMDRKFRFHD-SSLVEAIKL--EEPLVQEFFRLLALCHT 496
            .....|. .|:......|.     .||:.......| :.|.:...|  ....:|||..:||:|:|
  Fly   637 NHPPSEL-EKIYSKPGAPA-----PPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNT 695

Zfish   497 VM--------------------------------------------------------------- 498
            |:                                                               
  Fly   696 VIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSI 760

Zfish   499 ------------------------------------------------------PEERN------ 503
                                                                  |..:|      
  Fly   761 PADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNS 825

Zfish   504 ---------------------------------------------EGELVYQAQSPDEGALVTAA 523
                                                         :|..:|:|:||||.|||.||
  Fly   826 ISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAA 890

Zfish   524 RNFGFVFRSRTPETITLYEM---GQAVTYQLLAILDFNNVRKRMSVIVRNPKGQ-LKLYSKGADT 584
            .::.....:|:|..| |..|   |....|::|.:|.|::.||.||::||....| :.||:||||:
  Fly   891 YSYDCCLLNRSPNQI-LVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADS 954

Zfish   585 ILFDRLDPSNEE-----LMFTTSEHLNEFAGEGLRTLALAYKDLDEDVFDEWTKKLLFASTALDN 644
            .:...|.|.:..     |...|.:.|:.:|.||||.|.:|.:.|:...:.:|..:......:|:|
  Fly   955 SIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLEN 1019

Zfish   645 REEKLGALYEEIEQGMMLLGATAIEDKLQEGVPETIACLTLANIKIWVLTGDKLETAMNIGYSCN 709
            ||.:|...:.::|..:.|||||.|||:||:|||||||.|..|.|.:|||||||.|||:||.||..
  Fly  1020 RERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAK 1084

Zfish   710 MLRDDMNEVFIISGHTMLEVQQELRTAKERIMGPSKDKFSSGL-----DMEKTELYSVDSVFEET 769
            :....|..:                    |:...|:|...:.:     |||..:..|.....:..
  Fly  1085 LFTQQMELI--------------------RLTARSRDAAETAINFYLTDMENDKTTSTLGYGQSL 1129

Zfish   770 IIAEYALIINGHSLAHALEAELEQIL--VDVACLCKSVICCRVTPLQKALVVELIKRHKRAVTLA 832
            ...:.||:::|.:|...|:.:.:.||  :.::..|.||:|||.||||||.:|:::|......|||
  Fly  1130 RKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLA 1194

Zfish   833 IGDGANDVSMIKTAHIGVGISGQEGMQAVLASDYSFAQFRYLQRLLLVHGRWSYHRMCNFLCYFF 897
            |||||||||||:.|.:|||||||||||||:|:|::..:||||:||||.||.|.|.|:...:.|||
  Fly  1195 IGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFF 1259

Zfish   898 YKNFAFTLVHFWYGFLCGFSAQTVYDQWFITLFNIVYTSLPVLAMGLFDQDVNEQYSLRYPNLYR 962
            |||.||..:.|||...||||.|.:.||.::.|:|:::||||.||:|::|:.|.|...|:.|.||:
  Fly  1260 YKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYK 1324

Zfish   963 PGQLNQLFNKRKFFTCTLQGVYTSFILFFIPYGAFMPAVRDDGAQISDQQAFAVTIATSLVIVVS 1027
            .|:|...:....|:...|..:|.|.::||:...|:  |..|.|.     ..|..||..|.:....
  Fly  1325 NGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAY--AESDVGI-----WEFGTTITASCLFANL 1382

Zfish  1028 VQIGLDTNYWTAVNHFFIWGSLAVY--FAILF---AMNSNGIFTIFPNQFPFIGSARNSLNQKIV 1087
            |...::...||.::...|..||..:  |||::   .||..|:.:.:...|....||       :.
  Fly  1383 VHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASA-------VH 1440

Zfish  1088 WLVILLNTVVCIMPMLAVRFIKTDLYPTHTDKVRLLQQATRRQRPQEQNLRRVRRTSSRRSAYAF 1152
            ||||:|:|||.::|.|.:..::..|.|..:.|| :||....|.| .|..|....|::|..|.|..
  Fly  1441 WLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKV-ILQSKRERSR-GEALLVTWSRSTSASSIYRI 1503

Zfish  1153 SHQQGYGELITS 1164
            :......::||:
  Fly  1504 TDYGSKNQIITT 1515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atp8b4XP_687715.4 PhoLip_ATPase_N 34..99 CDD:292826 27/77 (35%)
ATPase-Plipid 48..1121 CDD:273734 403/1269 (32%)
Cation_ATPase 493..591 CDD:289987 41/270 (15%)
HAD_like <830..861 CDD:304363 27/31 (87%)
PhoLip_ATPase_C 861..1115 CDD:292829 93/259 (36%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/52 (44%)
ATPase-Plipid 250..1473 CDD:273734 403/1270 (32%)
E1-E2_ATPase 302..>394 CDD:278548 40/93 (43%)
Cation_ATPase <880..965 CDD:289987 34/86 (40%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 93/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.