DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PRKG1 and Pkg21D

Sequence 1:NP_006249.1 Gene:PRKG1 HGNCID:9414 Length:686 Species:Homo sapiens
Sequence 2:NP_477213.1 Gene:Pkg21D FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster

Alignment Length:765 Identity:372/766 (49%)
Similarity:488/766 (64%) Gaps:102/766 (13%)


Human    19 RQRDALIDEL--------ELELDQKDELIQKLQNELDKYRSVIRPAT------------------ 57
            |:|:|::..|        |:...::.||: ||..|:.|.:||::..|                  
  Fly     9 REREAIVSNLTKDVQALREMVRSRESELV-KLHREIHKLKSVLQQTTNNLNVTRNEKAKKKLYSL 72

Human    58 ------QQAQKQS------------------------------ASTLQGEP--RT---------- 74
                  |:::.|:                              |||....|  ||          
  Fly    73 PEQCGEQESRNQNPHLCSSCGMVLPTSPEFALEALSLGPLSPLASTSSASPSGRTSADEVRPKAM 137

Human    75 ----KRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMY 135
                |:|.:|||.....:|....:.:|.|.|....|..||:||:||||:||::.||::|:||.||
  Fly   138 PAAIKKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMY 202

Human   136 PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLV 200
            .........:|:||:||:.:||...|:..|.::|..|..||.||.||||||||||||||:::.|.
  Fly   203 SKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLS 267

Human   201 N-VKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYII 264
            . .::|.:||:.||.|||.|||.:....:.||:|||...:|.||:|:|:|||||...|..|.|||
  Fly   268 EAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYII 332

Human   265 RQGARGDTFFIISKGTVNVTREDSP-SEDPVFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVT 327
            |||..||:||:||:|.|.||::.:| |.:...||||.:||:|||:||..||.||||:|| :..|.
  Fly   333 RQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVE 397

Human   328 CLVIDRDSFKHLIGGLDDVSNKAYEDA---------------EAKAKYEAEAAFFANLKLSDFNI 377
            ||.:||||||.|||.|.::..|.|.|.               |.|.:.:.|   |.:|||:|..:
  Fly   398 CLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESCRDEPKEQLQQE---FPDLKLTDLEV 459

Human   378 IDTLGVGGFGRVELVQLKSEES-KTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYR 441
            :.|||:|||||||||:...::. ..||:|.|||||||||:|:|||.||:.||..:.|.||.||||
  Fly   460 VSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYR 524

Human   442 TFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLI 506
            ||:|.||:|||:|||:|||:||:|||||||||:..:|...||::||.|||::||||||||||||:
  Fly   525 TFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLM 589

Human   507 LDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSP 571
            ||.|||.|:|||||||:||...|||||||||||||||||||||||.:.|||:||||::|||.|:|
  Fly   590 LDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTP 654

Human   572 PFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEG 636
            |||.||||:|||:||:|||||.|||.|::.|..|||:||||.||||||....|::||:|||||.|
  Fly   655 PFSAPDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLG 719

Human   637 FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 686
            |:|:||....|.||.:..:|.|||...||.||.|.:| |||:.||||.||
  Fly   720 FDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNE-PPDELSGWDADF 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PRKG1NP_006249.1 DD_cGKI-beta 4..55 CDD:213375 13/44 (30%)
CAP_ED 118..227 CDD:237999 51/110 (46%)
CAP_ED 237..341 CDD:237999 60/106 (57%)
STKc_cGK 381..641 CDD:270724 179/261 (69%)
S_TK_X 636..>679 CDD:214529 21/43 (49%)
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 102/203 (50%)
CAP_ED 185..285 CDD:237999 47/100 (47%)
CAP_ED 304..419 CDD:237999 62/115 (54%)
Pkinase 457..717 CDD:278497 176/260 (68%)
STKc_cGK 463..724 CDD:270724 179/261 (69%)
S_TK_X 719..>760 CDD:214529 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0664
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D123183at33208
OrthoFinder 1 1.000 FOG0001078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127599
Panther 1 1.100 O PTHR24353
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2508
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.