DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Catsup

DIOPT Version :8

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_524931.1 Gene:Catsup / 48805 FlyBaseID:FBgn0002022 Length:449 Species:Drosophila melanogaster

Alignment Length:358 Identity:109/359 (30%)
Similarity:160/359 (45%) Gaps:74/359 (21%)


Human   311 SQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTCTGCRGVTHYILQTFLSLAVGAVTGD 375
            ::::|    .|..|..:|:...:||||. .|.|.||.:............|:..|:.|.|.:.||
  Fly   120 TKAKP----DLDMSTIWLHSIGSTLLIS-AAPFVLLYIIPLDNSEAMKPRLKVLLAFASGGLLGD 179

Human   376 AVLHLTPKVLGLHTHSEEG-----------------------LSPQPTWRLLAMLAGLYAFFLFE 417
            |.|||.|.....|:|.|.|                       :|..     |.:|.|:.||...|
  Fly   180 AFLHLIPHATHPHSHGEHGHDHGHDHHHHHDGEEHEHGHSHDMSIG-----LWVLGGIIAFLSVE 239

Human   418 NLFNLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKP-PHEGSRADLVAEES--- 478
            .|..:|           ..||..|   |||||     ||    :||| |.:...:|  .|:|   
  Fly   240 KLVRIL-----------KGGHGGH---GHSHG-----AP----KPKPVPAKKKSSD--KEDSGDG 279

Human   479 -----PELLNPEPRRLSP--ELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCH 536
                 |..:..:.....|  |:.:..|:....|..|||.||||:||::.:....|:.|::.:..|
  Fly   280 DKPAKPAKIKSKKPEAEPEGEVEISGYLNLAADFAHNFTDGLAIGASYLAGNSIGIVTTITILLH 344

Human   537 ELPHELGDFAALLHAGLSVRQALLLNLASALTAFAGLYVA-LAVGVSEESEAWILAVATGLFLYV 600
            |:|||:||||.|:.:|.|.|:|:||.|.:||.|.||..:| |..|..:.|..|:|....|.|:|:
  Fly   345 EVPHEIGDFAILIKSGCSRRKAMLLQLVTALGALAGTALALLGAGGGDGSAPWVLPFTAGGFIYI 409

Human   601 ALCDMLPAML----KVRDPRPWLLFLLHNVGLL 629
            |...:||.:|    |::.....:..||..|.|:
  Fly   410 ATVSVLPELLEESTKLKQSLKEIFALLTGVALM 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 None
CatsupNP_524931.1 Zip 129..446 CDD:280666 107/346 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.