DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Zip99C

DIOPT Version :8

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster

Alignment Length:350 Identity:98/350 (28%)
Similarity:156/350 (45%) Gaps:74/350 (21%)


Human   327 YLYGSLATLLICLCAVFGLLLLTCTGCRGVTHY-------ILQTFLSLAVGAVTGDAVLHLTPKV 384
            :::..|.:::|.|..:|.|:::..........|       :|:..||.|||.:.||..|||.|: 
  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPE- 99

Human   385 LGLHTHSEEGLSPQPT---------WRLLAMLAGLYAFFLFENLFNLLLPRD-----PEDLEDGP 435
                  :.||.:..|:         |    :|:|:..|.:.|.:|:.....|     |:.:|...
  Fly   100 ------AWEGDNQDPSSHPSLRSGLW----VLSGILIFTIVEKIFSGYASADEENPQPKCVEIAN 154

Human   436 CGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADL----------VAEESPELLNPEPRRLS 490
            |  ....|||       ||...|..:..    |...|:          ..|:..:....:|::::
  Fly   155 C--LLRRHGG-------QLPEGETSESC----GGACDIEDVGKVCFLREQEQKSKERKEQPKKVA 206

Human   491 PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSV 555
            ..|.|      |.:::.||..||||..:|..|::.|:..:.|:..||:|||:||||.||.:|.|.
  Fly   207 GYLNL------LANSIDNFTHGLAVAGSFLVSFRHGILATFAILLHEIPHEVGDFAILLRSGFSR 265

Human   556 RQALLLNLASALTAFAGLYVALAV----GVSEESEA---WILAVATGLFLYVALCDMLPAMLKVR 613
            ..|.   .|..|||.|||..||..    ||:...||   ||:....|.||::||..:||.:||..
  Fly   266 WDAA---RAQLLTAGAGLLGALVAIGGSGVTSAMEARTSWIMPFTAGGFLHIALVTVLPDLLKEE 327

Human   614 DPR---PWLLFLLHNVGLLGGWTVL 635
            :.:   ..||.|:..:.|:...|:|
  Fly   328 ERKESIKQLLALVFGIALMAVMTML 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 None
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 96/347 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.