DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Zip71B

DIOPT Version :8

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_001097608.1 Gene:Zip71B / 39626 FlyBaseID:FBgn0036461 Length:572 Species:Drosophila melanogaster

Alignment Length:590 Identity:172/591 (29%)
Similarity:258/591 (44%) Gaps:183/591 (31%)


Human   196 FHALP-SPQY--FVDFVFQQHSSEVPMTLAELSALMQRLGVGR----EAHSDHSHRHRGASSRDP 253
            |..:| |.:|  :|..:||::.:...:....|..||..|.:|:    .:|:...||.:|.|:..|
  Fly    19 FKTVPASTEYNKYVAQIFQKYGNGGTINFEGLEHLMFSLNLGQIQFDPSHTIDQHRPQGYSNEMP 83

Human   254 --------------------------VPLISSSNSSS---------VWD-------------TVC 270
                                      .|..:.|||.|         :.|             ..|
  Fly    84 HATNVTYYFEPTRVNATDEEALELQISPRGNHSNSQSEAEVPEFLEIHDPKHRHPRESSEPVAAC 148

Human   271 LSAR-------------------------DVMAAYGL--SEQ--------AGVTPEAWAQLSPAL 300
            ||.:                         ||.:..|:  ||:        ..:||.|:.:|.|||
  Fly   149 LSPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSSTDGVHNSEEEYNEFINSVRITPRAFMKLCPAL 213

Human   301 LQQQLSGACTSQSRPPVQD-QLSQSER-----YLYGSLATLLICLCAVFGLLLLTCTGCRGVTHY 359
            |.|..:|.|   .:|.|:. .|:...:     ::|.|:..|::..|.:.|:||:.......... 
  Fly   214 LAQIDNGVC---KQPAVRSVNLNDKNQKIWYAWIYASITMLILSACGLLGILLVPLMKSAAYQE- 274

Human   360 ILQTFLSLAVGAVTGDAVLHLTP-----------KVLGL------HTHSEEGLSPQPTWRLLAML 407
            ||:..:|:|||.:.|||::||.|           :|.|:      |.||.|.          |:|
  Fly   275 ILKFLVSIAVGTLAGDALMHLLPHALFKEEKHEEEVTGINPLESDHKHSNEA----------ALL 329

Human   408 AG---LYAFFLF--ENLFNLLLPRDPEDLEDGPCGHSSHSHG-GHSHGVSLQLAPSELRQPKPPH 466
            .|   |.|.|::  |||..|        |:.|..|| .|||| |||||.|               
  Fly   330 CGCTFLAALFMYMLENLIPL--------LKGGKPGH-GHSHGHGHSHGRS--------------- 370

Human   467 EGSRADLVAEESPELLNPEPRRL------------SPELRLLP--YMITLGDAVHNFADGLAVGA 517
            .|......|:::.:|  |.||.|            :|:..|.|  :|:.:||.:||..||||:||
  Fly   371 HGHMEKPAAKDAIDL--PPPRELNVMLQEAKLDEKTPDRPLTPVAFMVIIGDGLHNLTDGLAIGA 433

Human   518 AFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALLLNLASALTAFAGLYVALAV-GV 581
            ||||...||.||:.||.||||||||||||.||..|:|:|:|:.:|:.|::.:|.|:.|.|.: |:
  Fly   434 AFASDPVTGFATAFAVLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGI 498

Human   582 SEESEAWILAVATGLFLYVALCDMLPAML------KVRDPRPWLLFLLHNVGLLGGWTVLLLLSL 640
            .:....||.|...|.|||:|..|::|.|.      |.:||:.   .::...|:|.|..::|.::|
  Fly   499 GDGMTQWIYAATAGSFLYIAFADLVPTMSVAHNPEKAKDPKG---IIIQIFGILLGGLIMLAIAL 560

Human   641 YEDDI 645
            .|.|:
  Fly   561 NEHDL 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 None
Zip71BNP_001097608.1 Zip 242..559 CDD:280666 123/357 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12191
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4006
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.