DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Zip48C

DIOPT Version :8

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster

Alignment Length:352 Identity:75/353 (21%)
Similarity:129/353 (37%) Gaps:96/353 (27%)


Human   274 RDVMAAYGLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLIC 338
            |.:.||.|.:....:....|:.|.||:                   ::::|. :|||..|.|.:.
  Fly    38 RSLDAALGFAAGVMIAASFWSLLKPAI-------------------EMAESS-HLYGVYAFLPVA 82

Human   339 LCAVFGLLLLTCTGCRGVTHYILQTFLSLAVGAVTGDAVLHLTPKV----LGLHTHSEEGLSPQP 399
            ...:.|.:.:  .||..:..|:         |..:.:.::.:|...    :.:......|::|  
  Fly    83 GGFLLGSIFV--YGCDKLMSYL---------GLNSTNMMIQMTQSKAKADIAIEDSKRNGVAP-- 134

Human   400 TWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLEDGPCGHSSHSHGGHSH----GVSLQLAPSELR 460
                                 :.|..:..:...|  |  .|..|.|.|.    |.|:    :|:.
  Fly   135 ---------------------DRLASKSLDSFSD--C--LSVQHSGESRRRKKGASI----NEME 170

Human   461 Q--PKPPHEGSRADLVAEESPELLNPEPRRLSPELRLLPYMITLGDAVHNFADGLAVGAAFASSW 523
            |  ...|.|..||:       :.|:...|     :.||...||    |||..:|||||.:|.:..
  Fly   171 QCTYTTPEEQQRAE-------DALSQWKR-----IMLLVVAIT----VHNIPEGLAVGVSFGAIG 219

Human   524 KTGLAT-------SLAVFCHELPHELGDFAALLHAGLSVRQALLL-NLASALTAFAGLYVALAVG 580
            .|..:|       ::.:.....|..|.....|..||.||::||.. .|:..:....|:..|:||.
  Fly   220 STNSSTFESARNLAIGIGIQNFPEGLAVSLPLHAAGFSVKRALWYGQLSGMVEPIFGVLGAVAVT 284

Human   581 VSEESEAWILAVATGLFLYVALCDMLP 607
            .:.....:.|:.|.|..:|:...|:||
  Fly   285 FANLILPYALSFAAGAMIYIVSDDILP 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 None
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 75/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.