DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC39A4 and Zip42C.2

DIOPT Version :9

Sequence 1:NP_570901.3 Gene:SLC39A4 / 55630 HGNCID:17129 Length:647 Species:Homo sapiens
Sequence 2:NP_610231.2 Gene:Zip42C.2 / 35580 FlyBaseID:FBgn0033097 Length:310 Species:Drosophila melanogaster


Alignment Length:312 Identity:60/312 - (19%)
Similarity:112/312 - (35%) Gaps:95/312 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   339 LCAVFGLLLLTCTGCRGVTHYILQTF--------------------LSLAVGAVTGDAVLHLTPK 383
            :.|:..|.|:|...|  ...|:|..|                    |:...|.:.....:|:.|:
  Fly    11 IVAIVVLFLVTLIFC--FIPYLLDRFYKWTQRPENNAREFKVVLCLLNFGGGVLIATTFIHMLPE 73

Human   384 VLGLHTHSEEGLSPQPTWRLLA----------MLAGLYAFFLFENLFNLLLPRDPEDLEDGPCGH 438
            |:       |.::.....|:||          :..|.|..:..|...:.::.|..:         
  Fly    74 VV-------EVVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQ--------- 122

Human   439 SSHSHGGHSHGVSLQLAPSELRQP---KPPHEGSRADLVA--EESPELLNPEPRRLSPELRLLPY 498
                              .:||:.   |...|..|.::|.  ||||:    ||.    .||.|..
  Fly   123 ------------------RKLREVVTIKDAGEELRTEIVVQPEESPK----EPN----WLRGLGI 161

Human   499 MITLGDAVHNFADGLAVGAAFASS--W-KTGLATSLAVFCHE--LPHELGDFAALLHAG--LSVR 556
            ::.|  ::|....|:|:|...:.|  | .||     |:..|:  |...:|....:.|..  |:|.
  Fly   162 IVAL--SLHELFGGMAIGLEMSVSTVWFMTG-----AISVHKLVLAFCIGMEIMMAHTRWLLAVV 219

Human   557 QALLLNLASALTAFAGLYVALAVGVSEES--EAWILAVATGLFLYVALCDML 606
            ..|:.::.:.:....|:.|:.:...::.|  ...:..:|.|..:||...:::
  Fly   220 YLLVFSIVTPIGVGIGIAVSESAAANQPSTVSGILQGLACGTLIYVVFFEIV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC39A4NP_570901.3 ZIP4_domain 46..196 CDD:375719
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255
Zip 328..638 CDD:308248 60/312 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..486 10/32 (31%)
Zip42C.2NP_610231.2 Zip 9..294 CDD:280666 60/312 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.