DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: THG1L and THG

Sequence 1:NP_060342.2 Gene:THG1L HGNCID:26053 Length:298 Species:Homo sapiens
Sequence 2:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster

Alignment Length:265 Identity:145/266 (55%)
Similarity:187/266 (70%) Gaps:19/266 (7%)


Human    30 MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEEL 94
            ||.|:||||:.||.||:.|.:.|:|:|:||:.||:|::.|:|.||||..||.:|...|..||:|.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

Human    95 EDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGR 159
            .|||:||||||||||||:::|..||||::|.:|:|.|.|:||||..|..:. :.||.|.|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

Human   160 VVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEF 224
            ||:|||.|.|||||||||||.|:||||||.||.|:.:.|||..||:.:|:||.:|||||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

Human   225 NINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKE 289
            .|||||...||||||:|:.::|             :.|:|     :|...||||.|:|...||||
  Fly   195 GINYNNLPAMYRKGTILLRKRV-------------ILGEK-----SRQAVVPLHEDLISSQFWKE 241

Human   290 HPEIL 294
            |.|||
  Fly   242 HTEIL 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
THG1LNP_060342.2 Thg1 31..291 CDD:226508 141/260 (54%)
Thg1 38..164 CDD:282322 68/126 (54%)
Thg1C 167..282 CDD:291110 60/115 (52%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 137/256 (54%)
Thg1 9..134 CDD:282322 68/126 (54%)
Thg1C 137..234 CDD:291110 60/115 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165997103
eggNOG 1 0.900 E1_COG4021
Hieranoid 1 1.000
Homologene 1 1.000 H5959
Inparanoid 1 1.050 296 1.000 Inparanoid score I2704
Isobase 1 0.950 0 Normalized mean entropy S995
OMA 1 1.010
OrthoDB 1 1.010 D1152974at2759
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 1 1.000 T1073571
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 LDO PTHR12729
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1510
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.