DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8b2 and CG33298

Sequence 1:NP_001355579.1 Gene:Atp8b2 MGIID:1859660 Length:1209 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1330 Identity:423/1331 (32%)
Similarity:660/1331 (50%) Gaps:256/1331 (19%)


Mouse    13 RAGAPPSWSQK---KPSWGTE-EERRARA----------NDREYNEKFQYASNCIKTSKYNIVTF 63
            |..|||.|.:.   ..:.|.: |||..|.          ..:..:...|:..|.|:|:||.:::|
  Fly   201 RTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSF 265

Mouse    64 LPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDATDDYFRHKSDNQ 128
            :|.||.|||..|||.||:|:::|..:|:||:......::|::.||.:|||||..:|..|..||.:
  Fly   266 IPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKR 330

Mouse   129 VNNRHSQVLINGVLQ---QEQWMNVCVGDIIKLENNQFVAADLLLLSSSEPHGLCYIETAELDGE 190
            :||...:| .:|..:   :.:|..:.||||:.|.||:.|.||:|||.:|:|.|:|||:|.:||||
  Fly   331 INNTTCRV-YDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGE 394

Mouse   191 TNMKVRQAIPVTSELGDVSQLARFDGEVICEPPNNKLDKFSGTL-YWKENKFPLSNQNMLLRGCV 254
            ||:|.|:.:....|:..:...::|...|..:.|..||.:|.|.| :....:.|:|.:.:|||...
  Fly   395 TNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESR 459

Mouse   255 LRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWIFGFLVCMGVILAIGNAIWEH 319
            |:||::..|:|::||.:||.|.|:...::||:.:::.||..|:|....|:.:.|:.|||..:|..
  Fly   460 LKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLS 524

Mouse   320 EVGTRFQV-YLPWDEAVDSAFFSGFLSFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDKKMF 383
            .. |.|.| |||.::.  :|.......||:||:||..::|:||||::|:.::...:.|:.:..:|
  Fly   525 SF-THFPVPYLPPNKL--TANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLF 586

Mouse   384 CMKKRTPAEARTTTLNEELGQVEYIFSDKTGTLTQNIMVFNKCSINGHSYGDVFDVLGHKAELGE 448
            ..:.....|.|...:.|||||:::||:|||||||:|.|:|.:|.:||..|......|........
  Fly   587 DAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPG 651

Mouse   449 RPEPVDFSFNPLADKKFLFWDSSLLEAVKMGDPHT---HEFFRLLSLCHTVM------------- 497
            .|.|      ||.....|..|.:.|.......||.   .||..:|::|:||:             
  Fly   652 APAP------PLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNAS 710

Mouse   498 ----------------------------------------------------------------- 497
                                                                             
  Fly   711 GIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVT 775

Mouse   498 ----------------------------------SEE-----KNE-------------------- 503
                                              ||.     ||:                    
  Fly   776 PSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKI 840

Mouse   504 -----------------------GELY--------YKAQSPDEGALVTAARNFGFVFRSRTPKTI 537
                                   |.:|        |:|:||||.|||.||.::.....:|:|..|
  Fly   841 TSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQI 905

Mouse   538 TVH--ELGTAITYQLLAILDFNNIRKRMSVIVRN-PEGKIRLYCKGADTILLDRLHP-----PTQ 594
            .|.  ..|....|::|.:|.|::.||.||::||. ...:|.||.||||:.::..|.|     |..
  Fly   906 LVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEG 970

Mouse   595 ELLSSTTDHLNEYAGDGLRTLVLAYKDLDEEYYEEWARRRLQASLAQDSREDRLASIYEEVESDM 659
            .|...|...|:.||.:|||.||:|.:.|:...|.:|..|..:..::.::||.||...:.::||::
  Fly   971 ILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNL 1035

Mouse   660 MLLGATAIEDKLQQGVPETIALLTLANIKIWVLTGDKQETAVNIGYSCKMLTDDMTEVFVVTGHT 724
            .|||||.|||:||.|||||||.|..|.|.:|||||||.|||:||.||.|:.|..|          
  Fly  1036 TLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQM---------- 1090

Mouse   725 VLEVREELRKARKKMVDSSHAVGNGFTYQGNLSSSKLTSVL----EAVAGEYALVINGHSLAHAL 785
                  ||.:...:..|::....|  .|..::.:.|.||.|    .....:.|||::|.:|...|
  Fly  1091 ------ELIRLTARSRDAAETAIN--FYLTDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFIL 1147

Mouse   786 E--ADMELEFLETACACKAVICCRVTPLQKAQVVELVKKYKKAVTLAIGDGANDVSMIKTAHIGV 848
            :  :.:.|.||..:..|.:|:|||.||||||.:|::||:.....||||||||||||||:.|.:||
  Fly  1148 DPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGV 1212

Mouse   849 GISGQEGIQAVLASDYSFSQFKFLQRLLLVHGRWSYLRMCKFLCYFFYKNFAFTMVHFWFGFFCG 913
            |||||||:|||:|:|::..:|::|:||||.||.|.|.|:.:.:.||||||.||..:.||:..:||
  Fly  1213 GISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCG 1277

Mouse   914 FSAQTVYDQYFITLYNIVYTSLPVLAMGVFDQDVPEQRSMEYPKLYEPGQLNLLFNKREFFICIA 978
            ||.|.:.||.::.|||:::||||.||:||:|:.|.|...::.|.||:.|:|.:.:...:|::.:.
  Fly  1278 FSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILL 1342

Mouse   979 QGIYTSVLMFFIPYGVFAEATRDDGTQLADYQSFAVTVATSLVIVVSVQIGLDTGYWTAINHFFI 1043
            ..:|.|:::||:....:||:  |.|     ...|..|:..|.:....|...::...||.::...|
  Fly  1343 DALYQSLVIFFVALCAYAES--DVG-----IWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSI 1400

Mouse  1044 WGSLAVY--FAILF---AMHSNGLFDMFPNQFRFVGNAQNTLAQPTVWLTIALTTAVCIMPVVAF 1103
            ..||..:  |||::   .|:..|:...:...|....:|.:       ||.|.|:|.|.::|.:..
  Fly  1401 VLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVH-------WLVIMLSTVVAVLPRLLL 1458

Mouse  1104 RFLRLSLKPDLSDTVRYTQLVRKKQKAQHR 1133
            ..:|:||.||.|     |:::.:.::.:.|
  Fly  1459 TTVRISLCPDDS-----TKVILQSKRERSR 1483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8b2NP_001355579.1 P-type_ATPase_APLT_Dnf-like 50..991 CDD:319770 377/1131 (33%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 411/1270 (32%)
E1-E2_ATPase 302..>394 CDD:278548 40/93 (43%)
Cation_ATPase <880..965 CDD:289987 33/85 (39%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 86/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.