DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dlip3 and madf-3

Sequence 1:NP_525003.2 Gene:Dlip3 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans

Alignment Length:272 Identity:58/273 (21%)
Similarity:102/273 (37%) Gaps:80/273 (29%)


  Fly     8 QDTFPKTEKMQRYYAE---------------------------RETTG-------PEFDDRLIKL 38
            :|.:.|.::.|:|..|                           :|.||       |.|...||..
 Worm    62 RDKYGKEKRKQKYGNEKSSWQYFKHLHFLDPHMTDRAEISPSRKEPTGVHEKIAEPCFGKNLILE 126

  Fly    39 VRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRF------LQTKWKNIRYNYLQEVKAIET 97
            ||.:|.:|||..|.||....|...|..|.::|    |:      :..:||..|..|::|.:.:. 
 Worm   127 VRRHPCLYDVRDPKYRHGDCRTQAWGMIIDKL----RYPGTVPSIYKQWKKHRDRYVREKRRLR- 186

  Fly    98 GQANPNVR---KRRFTEDLSFLQ---NTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLK 156
            ...:|||:   .....:|::::.   :..|.....:|.......:|...|..|:...|.|..:..
 Worm   187 NLGDPNVQDVSTWEMYDDMAWIDQHLDEQQLSRCARSLKRGGNNDGGNQDEMSDYGDYDDDINYV 251

  Fly   157 IDASEGYDIIELDNSD---DGSNSDDNEIVPELQLVMGE-----SKQQLSLPTTLNGTSSSNHSH 213
            :.|.:     ..:|.|   ||.::....||.:|: .:||     :|||:.:..            
 Worm   252 MMAEK-----RPNNGDVLLDGDSAFSASIVSDLR-TLGEEARIIAKQQIMILL------------ 298

  Fly   214 EHDQASSPASSP 225
               :::.|.|:|
 Worm   299 ---ESAKPPSTP 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dlip3NP_525003.2 MADF 34..118 CDD:214738 25/96 (26%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 5/32 (16%)
MADF 122..212 CDD:214738 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.