DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Jafrac2 and prdx2

Sequence 1:NP_001261350.1 Gene:Jafrac2 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001002468.1 Gene:prdx2 ZFINID:ZDB-GENE-030326-2 Length:197 Species:Danio rerio

Alignment Length:191 Identity:130/192 (68%)
Similarity:158/192 (82%) Gaps:0/192 (0%)


  Fly    50 AVISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKT 114
            |.|.:|||||:.||||:.:...:.||.|.||||||.||||||||||||||||||:|.|||:||..
Zfish     6 AKIGQPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGV 70

  Fly   115 EVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQT 179
            |:|..|.||||:||||||||||:||||.:.|||::|||..||:||||..|..|.|.||||:||..
Zfish    71 ELIAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDK 135

  Fly   180 GVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAK 240
            |:|||||:||||||||||||:|||||||:||.:||||||||:||:|||||:.::..::|:|
Zfish   136 GILRQITINDLPVGRSVDETLRLVQAFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFFSK 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 AhpC 51..241 CDD:223527 129/191 (68%)
PRX_Typ2cys 52..223 CDD:239313 121/171 (71%)
prdx2NP_001002468.1 PTZ00253 1..195 CDD:140280 129/189 (68%)
PRX_Typ2cys 8..179 CDD:239313 121/171 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1326484at2759
OrthoFinder 1 1.000 FOG0000331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126593
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.