DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Jafrac2 and Jafrac1

Sequence 1:NP_001261350.1 Gene:Jafrac2 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001285202.1 Gene:Jafrac1 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster

Alignment Length:187 Identity:124/188 (66%)
Similarity:146/188 (78%) Gaps:0/188 (0%)


  Fly    52 ISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEV 116
            :.||||.|.||||||.....:.||.|.|||:||.||||||||||||||||||:..|||:||..||
  Fly     4 LQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEV 68

  Fly   117 IGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGV 181
            ||.|.||.||||||||||||:||||.:.||||:|.:.|:::||||..|.:|...|||||||....
  Fly    69 IGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQN 133

  Fly   182 LRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYF 238
            |||||:|||||||||:||:||||||||||.:||||||.|:||..|:|.:|.:..:||
  Fly   134 LRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYF 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Jafrac2NP_001261350.1 AhpC 51..241 CDD:223527 124/188 (66%)
PRX_Typ2cys 52..223 CDD:239313 118/171 (69%)
Jafrac1NP_001285202.1 PTZ00253 3..193 CDD:140280 124/188 (66%)
PRX_Typ2cys 4..175 CDD:239313 118/171 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295034009
eggNOG 1 0.900 E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1098
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1326484at2759
OrthoFinder 1 1.000 FOG0000331
orthoMCL 1 0.900 OOG5_126593
Panther 1 1.100 P PTHR10681
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.