DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and SLF1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_010803.3 Gene:SLF1 SGDID:S000002923 Length:447 Species:Saccharomyces cerevisiae

Alignment Length:555 Identity:113/556 (20%)
Similarity:185/556 (33%) Gaps:213/556 (38%)


  Fly   309 NNNAQNTASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATT 373
            |:|.:||:|..:.:::|                                    |||....|..||
Yeast     7 NDNPKNTSSAAEDKKKQ------------------------------------TSSLKLAPIPTT 35

  Fly   374 ETATTTTVDASQADALAKVVVKDKKKVNQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKK 438
            ....:::.|::..     :.|::.:.:::.|....|          .|||.|.||| .|..|.  
Yeast    36 SPWKSSSPDSNTV-----IPVEELRDISKTAKPSKN----------GSGSIKLTSN-TKWTPI-- 82

  Fly   439 QQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNS----NPSSSTTTTNTTTNSQATTAPVAST 499
                 |.:.:.:.|..|:|:....|..:.|......    |...:....|..|||   |:.:::.
Yeast    83 -----TPSVIISGSKDTNSKSGKNSKNSKTNKKMKKRGKYNNDINKKDFNGQTNS---TSEISNV 139

  Fly   500 SHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDD 564
            |:......||....|..:.:..||.|.  .|:|              ::......||.:|.    
Yeast   140 SNLESKPLDANAKVNIHSSSGATANGN--IKRI--------------TNNNNSTNGRQSRN---- 184

  Fly   565 IADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQR 629
                      |.:|..       ::|:.:..||                  |.::....:|    
Yeast   185 ----------YQNRNG-------KTRYNNNSRH------------------SQAANNAISF---- 210

  Fly   630 SGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPR--HLLASGEYANY 692
                                |..|:                  .||.| ||.  |.|.:....:|
Yeast   211 --------------------PNNYQ------------------ARPEY-IPNASHWLNNNSRNSY 236

  Fly   693 LPADAAGADSQSSYVLMGTHYFGNV--------PAAY-IELDANSIKEAIKKQVEYYFSVDNLTG 748
                     .|.|| .....|:.|:        |..| :|....|| |:||.|:|:|||.:||..
Yeast   237 ---------KQLSY-FRQQQYYNNINYQQQLQTPYYYSMEPIFKSI-ESIKNQIEFYFSEENLKT 290

  Fly   749 DFFLRRKMDP--EGYIPVTLIASFHRV--LALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTT 809
            |.|||.|...  :|:||::||..|:|:  |:|..|..:|:.:::|                    
Yeast   291 DEFLRSKFKKANDGFIPMSLIGKFYRMVNLSLGGDPNLILASMRE-------------------- 335

  Fly   810 WPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLE 844
              :.:..|.|..| .|:|::|..|....|....||
Yeast   336 --VLQHKETNHLE-IALGSIEGAQKNMADDFNPLE 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/77 (35%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
SLF1NP_010803.3 LHP1 3..443 CDD:227520 113/556 (20%)
La 275..335 CDD:283126 25/60 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T133849
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.