DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LHP1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_010232.1 Gene:LHP1 SGDID:S000002209 Length:275 Species:Saccharomyces cerevisiae

Alignment Length:251 Identity:55/252 (22%)
Similarity:94/252 (37%) Gaps:77/252 (31%)


  Fly   720 AYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDP-EGYIPVTLIASFHR----------V 773
            |.||.....:...: ||||:|||..|...|.|||...:. :|::|::.||:|:|          :
Yeast    21 AVIEFTPEVLDRCL-KQVEFYFSEFNFPYDRFLRTTAEKNDGWVPISTIATFNRMKKYRPVDKVI 84

  Fly   774 LALTTDVAVIVNA----IKESDKLELFEGYKVRTKTTPTTWPI----------TEVPEVNEGEP- 823
            .||.:...:.|:|    :|....|:|......|.:....|..:          :::||:.|... 
Yeast    85 EALRSSEILEVSADGENVKRRVPLDLTAARNARIEQNQRTLAVMNFPHEDVEASQIPELQENLEA 149

  Fly   824 --KAIGTLEQEQLEQNDGQEK------------------LEEQTEADSPPPILT------SAMAT 862
              |.:|.:.|.:|.::...:|                  |:..:..|....||:      |.:..
Yeast   150 FFKKLGEINQVRLRRDHRNKKFNGTVLVEFKTIPECEAFLKSYSNDDESNEILSYEGKKLSVLTK 214

  Fly   863 K-------------------PLNSIPPPPMPRNPQNLVPKMLQDKQQSR--SSTIA 897
            |                   ..|......:|:.|:|   |....|::|:  ||.||
Yeast   215 KQFDLQREASKSKNFSGRSRSFNGHKKKNLPKFPKN---KKKNGKEESKEDSSAIA 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/88 (30%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LHP1NP_010232.1 LAM 1..>244 CDD:322071 45/224 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.