DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and SRO9

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_009893.2 Gene:SRO9 SGDID:S000000542 Length:434 Species:Saccharomyces cerevisiae

Alignment Length:548 Identity:116/549 (21%)
Similarity:187/549 (34%) Gaps:184/549 (34%)


  Fly   365 AAAVPAATTETATTTTVDASQADALAKVVVKDKKKVNQKASDFSNVGDW---PTLIGGTSGSGK- 425
            :|...||.|.||....|...::        ...|:||...:.......|   ||.|..::.|.: 
Yeast     2 SAETAAANTATAPVPEVQEQES--------SKSKQVNLTPAPLPTSSPWKLAPTEIPVSTISIED 58

  Fly   426 --ATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSNPSSSTTTTNTTTN 488
              ||..:..|.||.|..:|.....:.||...:.::.:...|.|   |:.|||.|.:..|..::|:
Yeast    59 LDATRKKKNRTPTPKSSTATKWVPIKASITVSGTKRSGSKNGA---SNGNSNKSKNNKTAASSTS 120

  Fly   489 SQATTAPVASTSHDAKAQRD-AEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKP 552
            |...........|:||.|:. .:....||.|.                       :.:|.:..:.
Yeast   121 SSNANRKKKHHQHNAKKQQQMKKDGFESAVGE-----------------------EDSKDATSQE 162

  Fly   553 IGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSWRSS 617
            .|         ....|::||   |.|           .|.|:..|                  :|
Yeast   163 NG---------QSTQQQQPP---HHR-----------NHHHSHHH------------------NS 186

  Fly   618 SSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRGG------------FSRQ 670
            :......|  ..|..||.....|.        |.::: ||: ||..|..            .::|
Yeast   187 NGPQRRKF--HNSNNAGMPQNQGF--------PPQFK-PYQ-GRNARNNNNNRSKYHNHFHHNQQ 239

  Fly   671 GPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEAIKK 735
            .|.:|..::.:         .:.|...         |||..:                   .|.:
Yeast   240 HPQQPMVKLQQ---------QFYPVQP---------VLMAIN-------------------NIAR 267

  Fly   736 QVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVL----------------------ALTT 778
            |:|||||.:|||.|.:||.|:..:|:.|::||:.|:||:                      |.|.
Yeast   268 QIEYYFSEENLTVDNYLRSKLSKDGFAPLSLISKFYRVVNMSFGGDTNLILAALREIVANEAATV 332

  Fly   779 DVAVIVNAIKESDKL-------ELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIG--------- 827
            :||....|.||.|.:       ...:.|.||:|:.....|.|...|:|. |.:.:|         
Yeast   333 NVAEGTLAAKEGDNVTGEAKEPSPLDKYFVRSKSWSNWLPETFETEINI-EKELVGDALDQFMIS 396

  Fly   828 --TLEQEQLEQNDGQEKLEEQTEADSPP 853
              .:.|::.|.:......|::|:.||.|
Yeast   397 LPPVPQQEEESSTELASQEQETKEDSAP 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 32/102 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
SRO9NP_009893.2 LHP1 1..434 CDD:227520 116/549 (21%)
LA 260..344 CDD:128955 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T133849
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.