DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP1b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_201411.2 Gene:LARP1b AraportID:AT5G66100 Length:453 Species:Arabidopsis thaliana

Alignment Length:437 Identity:104/438 (24%)
Similarity:174/438 (40%) Gaps:99/438 (23%)


  Fly   436 TKKQQSAKTAAAVAASSNTTSSE--------VATESNVAGTTSSSNSNPSSSTTTTNTTTNSQAT 492
            |....:|.:|:..:..|:.:.|.        :.::|:...|.|.|..:|.|:.:.:..|.|:   
plant     4 TTASSAANSASRFSIDSSISRSRHGDSSPWLLPSDSHDHPTLSLSQDDPFSAPSVSPPTGNN--- 65

  Fly   493 TAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRP 557
                 |:.:| .|.:...|..|..:..:.:..||.:.   ....|..|.:. |:||..|......
plant    66 -----SSDYD-NADKKPPPVWNMPSSNSSSDVGPVMG---AAESWPALSLS-ARSSSIKSPSLDA 120

  Fly   558 NRRFSDDIADQRRPPRVYHDRQPGA-GGAGV------ESRHPHAGRHPYGSRPATATSERVDSWR 615
            ::.|.|..:....||:...:....| .|:.|      .|...::.|.|:.....|::|.      
plant   121 SKPFPDGSSSSIPPPQATSNTSTNANAGSSVSATSSENSAVNNSQRKPFRRNNNTSSSS------ 179

  Fly   616 SSSSTTTAA----FDEQRSGAAGGAGAAGT--------GVGSATRGPRRY---RTPYRGGRQGRG 665
            :||:.:.||    .|:..|...||:..:|.        ...|..||...:   |..|..|.|  .
plant   180 TSSNVSNAAPLNTRDQNHSQRGGGSFGSGNFRNSQRNRNSSSYPRGEGLHHGNRRNYEHGNQ--S 242

  Fly   666 GFSRQG---------PGRPTYRI-PRHLLASGEY----ANYLPADAAGA-------DSQSSYVLM 709
            |||.:.         |.|....| |:.|:....:    |.|:.|...|:       ...:.:|.|
plant   243 GFSHRNYSGRDMHLQPQRGVGMIRPQMLMGPPSFPASSAQYMAAPQLGSYGGPIIYPDYAQHVFM 307

  Fly   710 GTH-----------------YFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMD 757
             .|                 ||.|..|.        :...|..|||||||.|||:.|..||.:|:
plant   308 -PHPSPDPMGLVGPFPLQPMYFRNFDAI--------LYNKILTQVEYYFSADNLSRDEHLRDQMN 363

  Fly   758 PEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRTK 804
            .||::||.:||:|.|:..||.::..|:.|::.|:.:|: :|..:|.:
plant   364 DEGWVPVRVIAAFRRLAELTNNIQTILEALRSSEVVEI-QGETLRRR 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 31/73 (42%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP1bNP_201411.2 LAM 336..409 CDD:153396 31/74 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.