DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP6a

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_851141.1 Gene:LARP6a AraportID:AT5G46250 Length:422 Species:Arabidopsis thaliana

Alignment Length:554 Identity:105/555 (19%)
Similarity:175/555 (32%) Gaps:225/555 (41%)


  Fly   688 EYANYLPAD-------AAGADSQSSYVLMGTHYFGNVPAAYIELDA-----NSIKEAIKKQVEYY 740
            |..|..|:|       .:|.|....:        |..|   :|.|.     :.:.:.|.:|||||
plant    61 EIPNLSPSDDDFDHERNSGEDRDQDH--------GENP---VETDGVVVPIDELNQKIIRQVEYY 114

  Fly   741 FSVDNLTGDFFL--RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRT 803
            ||.:||..|.||  ..|.:.:|::|::.||:||::..||.|.|:||:|:|||..|.:....|...
plant   115 FSDENLPTDKFLLNAMKRNKKGFVPISTIATFHKMKKLTRDHALIVSALKESSFLVVSADEKKVK 179

  Fly   804 KTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSI 868
            :.:|       :||:.  :|| |.|:..|.|.::...|.:.|                       
plant   180 RLSP-------LPEIR--DPK-IFTVLVENLPEDHSNENIRE----------------------- 211

  Fly   869 PPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPK 933
                                                                  :.|.|.|:|..
plant   212 ------------------------------------------------------IFGKAGSIKSV 222

  Fly   934 STSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNN 998
            |...|   ||.......|.            ||...|::.:|..|..|....::   .:.||||.
plant   223 SICDP---NAVEESEKGGK------------KENFIRTRLHAFVEYETVEAAEK---AAATLNNE 269

  Fly   999 ND---NVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATTKTTTTSTATTTTNNNIK 1060
            .|   .::.......:...:...|                  |.:...|...|:           
plant   270 QDWRNGLRVKLLEQAAGKFAQRRP------------------ARREVDKEKDTT----------- 305

  Fly  1061 SGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRINNFTENFSDDDESD 1125
              ...:.:|..:.:.||....:.:.|                           .::|.:|||..:
plant   306 --GRVHDQTGGEKNKKTREHQNHRLH---------------------------HSDNPADDDGGN 341

  Fly  1126 YEFADRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVA 1190
            :: .|::.||..:|.| ||...|:|                 .|.|..|.        .:::...
plant   342 HQ-KDKNGNKGRVVGQ-GRRQNHQG-----------------GNGIGHGT--------ASSSSHP 379

  Fly  1191 DYKTVNVISQADFEKLAG-------GRNKSVLPP 1217
            :|..|.|..:....::..       ||.|::.||
plant   380 NYHPVEVSKRPPGPRMPDGTRGFTMGRGKAIPPP 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 32/75 (43%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP6aNP_851141.1 LA 101..180 CDD:128955 32/79 (41%)
RRM_La_like_plant 193..282 CDD:240734 25/184 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.