DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP1a

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001190354.1 Gene:LARP1a AraportID:AT5G21160 Length:833 Species:Arabidopsis thaliana

Alignment Length:1172 Identity:290/1173 (25%)
Similarity:407/1173 (35%) Gaps:434/1173 (37%)


  Fly   373 TETATTTTVDASQADALAKVVVKDKKKVNQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTK 437
            |.|:...|:||....|                      ..||.|      :..|....||..|. 
plant    30 TTTSPVETIDAPVMGA----------------------HSWPAL------ADAAQQPRPKNPPA- 65

  Fly   438 KQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHD 502
                  .|.|..:.:..||..:.|.: |.|...|.....                    |:..|.
plant    66 ------PAPAPPSKNIPTSIPIPTPA-VTGQAKSKGGGK--------------------ANPGHK 103

  Fly   503 AKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIAD 567
            ..:.|.::|...|  ...|....|.|...:|.|              |.|.              
plant   104 NPSGRHSKPGPRS--NQNGPPPPPYLVHAVPYH--------------PPPF-------------- 138

  Fly   568 QRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGA 632
               ||.|     |....||.:  .|:|...|| ..|....:|..:..:..:|.........: |.
plant   139 ---PPMV-----PLPHAAGPD--FPYAPYPPY-PVPVPPVTESGNEKQVQASPLPPVLPAPQ-GD 191

  Fly   633 AG-------GAGAAGTGVGSATRGPRRY-RTPYRGGRQGRGGFSRQGPG--RPTYRIPRHLLASG 687
            .|       |........|:   |||.: |.|:.|  ...|.....|||  .|.|          
plant   192 PGKPWPHQRGFDPRNMPQGA---GPRNFGRPPFMG--PAPGFLVGPGPGFPGPVY---------- 241

  Fly   688 EYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFL 752
                |||....|| .:..|......|..|.....:..:...:::.:.||||||||.:||..|.:|
plant   242 ----YLPGPPPGA-IRGPYPPRFAPYPVNQGPPILSPEKLDLRDRVLKQVEYYFSDENLENDHYL 301

  Fly   753 RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPE 817
            ...||.||::|..:||.|.||.|:|.||..||.|:..|:.:|: :|.::|.:...:.|    :| 
plant   302 ISLMDEEGWVPTKIIAGFKRVKAMTMDVDFIVYALGFSNSVEV-QGDQIRKRDKWSDW----IP- 360

  Fly   818 VNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVP 882
                                                       |:|                   
plant   361 -------------------------------------------ASK------------------- 363

  Fly   883 KMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAG 947
                                                              ||||      |.:.|
plant   364 --------------------------------------------------KSTS------AETIG 372

  Fly   948 NGAGSAAALVAEPEGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSK 1012
            :|                                    .:..|.|.|..:|..|           
plant   373 DG------------------------------------DKDSPKSITSGDNFGN----------- 390

  Fly  1013 SSSNNAPSNASSSATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKT 1077
                  ||..||..||    ::.||....:::|           ||.||||.       |||:. 
plant   391 ------PSKGSSKPTV----SDFSSEGAQSSRT-----------NNYKSGNL-------KSSAD- 426

  Fly  1078 AAPPSAQCHAEKEELD---------FQFDEEL----MDPLPPGTGRINNFTENFSDDDESDYEFA 1129
                      ||..::         |..||||    ..|...|.....:.  .:.|||.:   ..
plant   427 ----------EKRNVEDLSNDFSNTFLLDEELDLEHRSPRKSGLSMSKSI--EYEDDDMA---VD 476

  Fly  1130 DRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKT 1194
            |:||.||:||.|  .:.|.:|  .....|....|.::|.:.|||||..:|::|            
plant   477 DQDIQKLVIVTQ--NSGKSDG--AGIGGTEAKNIPKELASTINDGLYYFEQEL------------ 525

  Fly  1195 VNVISQADFEKLAGGRNKSVLPPQVVPPPPPFEEDLD------------ETLVGDTTLNSTLNN- 1246
                     :|...||.|:             ...||            .|.:|:   ||..|: 
plant   526 ---------KKKRSGRRKN-------------NSHLDTKDGKIKSGEGLNTKLGE---NSAANDG 565

  Fly  1247 -----TLKSRRARFYAAPNSHSIDPRTPRKRKLRHTAN---PPVEAHVGWLLDTV---EHRPRTT 1300
                 .:.|||.:.......|:...|......:|:..|   .|..:.:|:...:.   .|.||.:
plant   566 GEEHGIITSRRKQNKGTHKHHTAHARRFFSSNIRNNGNISESPPSSSIGFFFGSTPPDSHGPRLS 630

  Fly  1301 SMGSS-----AGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRR 1360
            .:.||     :|:||..       .|:|:|.|.||||||.||:||.|.|:.|.||..|||.||::
plant   631 KLSSSPQCTLSGSSPPV-------GSLPKSFPPFQHPSHQLLEENGFKQEKYLKYRKRCLNERKK 688

  Fly  1361 LGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRP 1425
            ||.|.|:|||.||||||:|||:.|..|||::|:..|||||...:.|||||||||:||||||.|..
plant   689 LGSGCSEEMNHLYRFWSYFLRDTFVLSMYDDFQKFALEDAAGNYDYGLECLFRFYSYGLEKHFDE 753

  Fly  1426 NIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLK-SFKNIEDFRVVEPEI 1489
            ::|:||:..::..|..|.||||||:|||..|....|.:...|:|.:.|| .|::|:|||..|...
plant   754 DLYKDFEKLSLDFYHKGNLYGLEKYWAFHHYRGKEEPITKHPELEKLLKEEFRSIDDFRAKETIT 818

  Fly  1490 NE 1491
            |:
plant   819 NQ 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 33/73 (45%)
DM15 1341..1382 CDD:128927 26/41 (63%)
DM15 1383..1421 CDD:128927 24/38 (63%)
LARP1aNP_001190354.1 LAM 279..351 CDD:153396 33/73 (45%)
DM15 670..710 CDD:128927 26/40 (65%)
DM15 712..749 CDD:128927 24/37 (65%)
DM15 750..785 CDD:128927 16/35 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I769
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoInspector 1 1.000 T193665
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 1 0.910 0.800 Consistency score
66.070

Return to query results.
Submit another query.