DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP1c

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_567991.1 Gene:LARP1c AraportID:AT4G35890 Length:523 Species:Arabidopsis thaliana

Alignment Length:650 Identity:146/650 (22%)
Similarity:240/650 (37%) Gaps:185/650 (28%)


  Fly   305 TASQNNNAQNTASNKK------------TQQQQQP-QQGATTTTQTTTAAAAAATAAAAATAATT 356
            :|:.||.|.::.|.::            .|..::| :|.::..||.....:....||||....::
plant     3 SATSNNPASSSMSPRRISGNHGSPTASVAQSPRRPSRQVSSPWTQIVRGESEPIAAAAAVAGPSS 67

  Fly   357 SAAAATSSAAAVPAATTETATTTTVDASQADALAKVV----VKDKKKVNQKASD-FSNVG----- 411
            ..:.|.....|..:....||...||:|:..|..::..    ...||.|.::.|: .|.||     
plant    68 PQSRAPIEPIASVSVAAPTAAVLTVEAAAGDEKSEASGGQDNAGKKPVWKRPSNGASEVGPVMGA 132

  Fly   412 -DWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATE----SNVAGTTSS 471
             .||.|    |.:.||.||:      ....|.|:...|.:||:.:||...|:    ::|.....:
plant   133 SSWPAL----SETTKAPSNK------SSSDSLKSLGDVPSSSSASSSVPVTQGIANASVPAPKQA 187

  Fly   472 SNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHK 536
            ..:||       |.|.|.        |.....| ||:.  |:.||.||....:......::|.| 
plant   188 GRANP-------NPTPNH--------SRQRSFK-QRNG--ASGSANGTVSQPSAQGSFTELPSH- 233

  Fly   537 WRPLPIDLAKSSRPKPIGGRPNRRF-SDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGR--HP 598
                        .|.|.|......| |.:......|.:  .|......|...:|   |.||  ..
plant   234 ------------NPSPRGQNQKNGFASQNHGGTENPSQ--RDSYRNQNGNHHQS---HGGRRNQE 281

  Fly   599 YGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQG 663
            :|::          :|         .|....:|..|.|.:                      ::|
plant   282 HGNQ----------NW---------TFQRSFNGREGNAQS----------------------QRG 305

  Fly   664 RGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSY---------VLMGTHYFGNV-- 717
            ...|.|. |......||: .:|:..:.:::|.....|  ||||         :..|..:|.:.  
plant   306 TPAFVRH-PSPTVQPIPQ-FMAAQPFPSHIPFPTELA--QSSYYPRMPYMTPIPHGPQFFYHYQD 366

  Fly   718 PAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAV 782
            |..:::|         .||::||||.:||..|.:||..|:.||::|:.::|.|.:|..||.::..
plant   367 PPLHMKL---------HKQIQYYFSDENLITDIYLRGFMNNEGFVPLRVVAGFKKVAELTDNIQQ 422

  Fly   783 IVNAIKESDKLELFEGYKVRTKTTPTTWPITEVP------EVNEGE--PKAIGTLEQEQLEQNDG 839
            ||.|::.|..:|: :|..:|.:.....|.:...|      .|:..:  .|.:|.|..:|      
plant   423 IVEALQNSPHVEV-QGDFIRKRDNWQNWVLRRNPTGSGPQSVDRADAVAKRLGNLSVDQ------ 480

  Fly   840 QEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNA 904
                      .|..||..|:...:|..:                 |.|.||..||| |.:::.||
plant   481 ----------SSADPIGGSSSQLQPTEA-----------------LSDDQQQSSST-APVSNHNA 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/73 (37%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP1cNP_567991.1 LHP1 <182..448 CDD:227520 78/357 (22%)
LAM 372..442 CDD:153396 28/80 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.