DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP6b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_566004.1 Gene:LARP6b AraportID:AT2G43970 Length:545 Species:Arabidopsis thaliana

Alignment Length:637 Identity:128/638 (20%)
Similarity:207/638 (32%) Gaps:236/638 (37%)


  Fly   468 TTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKI 532
            |..||...|:.|...:::.:.|..|:   ||:|.|....|       |.:.:...|..|..   :
plant     6 TLDSSTPPPTQSDDLSHSHSTSSTTS---ASSSSDPSLLR-------SLSLSRLNAGAPEF---V 57

  Fly   533 PKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPP----RVYHDRQP-GAGGAG------ 586
            |.....|||      ..|:.|...|             ||    .:||.:.| .....|      
plant    58 PGRTTPPLP------QPPRMIIPPP-------------PPHGMLHMYHHQPPFNTPVLGPVPIQP 103

  Fly   587 ----VESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSAT 647
                |::.|||...|.:...                                            .
plant   104 HLVPVQNHHPHHRFHQHHHH--------------------------------------------N 124

  Fly   648 RGPRRYRTPYR--GGRQGRGGF-SRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLM 709
            |...:...|.|  |..|.|||. ..|.|...:.:..|.             |.:..:|::..|  
plant   125 RHQNQQYVPVRNHGEYQQRGGVGGEQEPDLVSKKNDRR-------------DHSKRESKNDQV-- 174

  Fly   710 GTHYFGNVPAAYIELDA------NSIKEAIKKQVEYYFSVDNLTGDFFLRRKM--DPEGYIPVTL 766
                  ....|.:.:|:      :||:: |..|||||||..||.....|.|.:  |||||:|:.:
plant   175 ------TETGASVSIDSKTGLPEDSIQK-IVNQVEYYFSDLNLATTDHLMRFICKDPEGYVPIHV 232

  Fly   767 IASFHRVLALTTDVAVIVNAIKESDKLELFE-GYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLE 830
            :|||.::.|:..:.:.:...::.|.||.:.| |.|||..:     ||||         .||..|:
plant   233 VASFKKIKAVINNNSQLAAVLQNSAKLFVSEDGKKVRRIS-----PITE---------SAIEELQ 283

  Fly   831 Q-----EQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPP-------PPMPRNPQNLVPK 883
            .     |.|.::...:.|.:         |.::..:.|.:.:..|       ||..|:       
plant   284 SRIIVAENLPEDHCYQNLMK---------IFSTVGSVKNIRTCQPQNNGSGAPPAARS------- 332

  Fly   884 MLQDKQQSRSSTIAALNSVNA-----ISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNA 943
                  .::|......|.|:|     |..|.::.....:|.....|||...:..|..:...|:  
plant   333 ------AAKSDGTLFSNKVHAFVEYEIVELAERAVTELSEAGNWRSGLKVRLMLKHQTKEPKQ-- 389

  Fly   944 ASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKENATTPPQQ-----------------QQPPL 991
               |.|.|.        :|...:|:..      :::|||..||                 |:.|:
plant   390 ---GQGRGR--------KGHDADVEHE------EDDATTSEQQPIEKQSDDCSGEWDTHMQEQPI 437

  Fly   992 SQTLNNN----------------------NDNVKTNNTSSKSKSSSNNAPSN 1021
            .:...|.                      :.|...||..|.:::.::|...|
plant   438 GEDQGNEKAAGQRKGRNRGRGKGRGRGQPHQNQNQNNNHSHNQNHNHNGRGN 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 30/76 (39%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP6bNP_566004.1 LARP_6 194..270 CDD:153402 31/77 (40%)
RRM_La_like_plant 285..380 CDD:240734 19/117 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.