DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Ssb

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_112381.2 Gene:Ssb RGDID:620804 Length:415 Species:Rattus norvegicus

Alignment Length:444 Identity:99/445 (22%)
Similarity:155/445 (35%) Gaps:121/445 (27%)


  Fly   728 SIKEAIKKQVEYYFSVDNLTGDFFLRR--KMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKES 790
            :::..|..|:||||...||..|.||:.  |:| ||::|:..:..|:|:..||||..|||.|:.:|
  Rat    12 ALEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLETMIKFNRLNRLTTDFNVIVQALSKS 75

  Fly   791 DKLELFE--GYKVRTKTTPTTWPITEVPEVNEGEPK----------AIGTLE--QEQLEQ----- 836
             |..|.|  ..|.:.:.:|:. |:.||.:..:.:.|          ...||:  :|.|:.     
  Rat    76 -KANLMEVSADKTKIRRSPSR-PLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLDDKGQIL 138

  Fly   837 NDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQD----KQQSRSSTIA 897
            |....:...:|...|...:..|..:.|..  :..|.......||:....:|    |.:.|..   
  Rat   139 NIQMRRTLHKTFKGSIFAVFDSIQSAKKF--VDTPGQKYKDTNLLILFKEDYFAKKNEERKQ--- 198

  Fly   898 ALNSVNAISALTQQVEG----GAAE---LAGHLSGLAESVKPKSTSTPDKRNAAS------AGNG 949
              :.|.|.....|:.||    |:.|   |.|.:..|.     |.:...|.:....      :.:|
  Rat   199 --SKVEAKLKAKQEHEGRHKPGSTETRALEGKMGCLL-----KFSGDLDDQTCREDLHFLFSNHG 256

  Fly   950 AGSAAALVAEPEGIWKEVKRRSKTNAI--KENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSK 1012
                       |..|.:..|.:|...|  ||.|       :..|.:..:.||.|:...|.....|
  Rat   257 -----------EIKWIDFVRGAKEGIILFKEKA-------KDALEKARSANNGNLLLRNKKVTWK 303

  Fly  1013 SSSNNAPSNASSSATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAA--YSKTH----- 1070
            ....:|..:|...    :|.:...|..|..:                |.|:||  :..:|     
  Rat   304 VLEGHAEKDAMKK----ITDDQQESLNKWKS----------------KGGHAARRFKGSHVFTAA 348

  Fly  1071 --SKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRINNFTENFSDDD 1122
              .|...|...|..|..                   |.|.|:.......|.|||
  Rat   349 RRFKGRGKGNRPAYAGA-------------------PKGRGQFQGRRTRFDDDD 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 31/77 (40%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
SsbNP_112381.2 LARP_3 10..91 CDD:153397 31/81 (38%)
RRM1_La 112..183 CDD:240737 12/73 (16%)
RRM_3 230..333 CDD:285930 24/146 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.