DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp6-like.1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001072636.1 Gene:larp6-like.1 XenbaseID:XB-GENE-5806148 Length:481 Species:Xenopus tropicalis

Alignment Length:406 Identity:92/407 (23%)
Similarity:130/407 (32%) Gaps:176/407 (43%)


  Fly   733 IKKQVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDK 792
            |..|||:|.|.:||:.|.||     :.||   ||:.:.|:.||.::..||.|....:.|::.|::
 Frog    83 IVSQVEFYLSDENLSHDAFLLKHVQKNKM---GYVSIKLLTSFKKIKYLTRDWRKTLYALRFSEQ 144

  Fly   793 LEL-FEGYKVRTKT---------TPT----TWPIT------------------------------ 813
            ||: .|..|||.|.         .||    .|.|:                              
 Frog   145 LEVNEEETKVRRKNPLPDYLLGLPPTKQLLVWNISDPEKRSFSCQQKNLMEIVTSVFATYGLITS 209

  Fly   814 --------EVP-----------------------EVNEGEPKA---------------------- 825
                    |||                       |..||..||                      
 Frog   210 IRILKPGKEVPSDIRKYMSRYPELSTRNCALVEYESLEGARKALEALSGKVSSTNIDRIKVIPVS 274

  Fly   826 ---------IGTLEQEQLEQND---------GQEKLEEQT---------EADSPP--PILTSAMA 861
                     |.|.|||.|:..|         ..|:|:..|         |:||.|  |:|.....
 Frog   275 GRGTRKKNVIDTAEQEDLDLPDKKMTRKEIRAMERLQYTTEDSSFYSSSESDSTPASPVLAPRYL 339

  Fly   862 TKPLNSIPP-----PPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAG 921
            : ||....|     ||...:|              |.||:.|..|   :|.........|:||  
 Frog   340 S-PLTFSSPSMMFKPPFFSSP--------------RPSTLYARKS---LSFSPHNPSPLASEL-- 384

  Fly   922 HLSGLAESVKPKSTSTPDKRNAA--SAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKEN---AT 981
               |:.:...| .||....|...  ||.|...|.:.        |.:.:|.:..|.:.|:   ..
 Frog   385 ---GIGDYPSP-GTSPEFSRKILDHSAENAMSSTSP--------WVQRRRAAAHNLLLESKPLPC 437

  Fly   982 TPPQQQQPPLSQTLNN 997
            :|...::.|:|..|||
 Frog   438 SPLAVKKLPVSLGLNN 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 29/76 (38%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
larp6-like.1NP_001072636.1 LARP_6 80..156 CDD:153402 29/76 (38%)
RRM_LARP6 171..274 CDD:240735 10/103 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120960508
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.