DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_006534397.1 Gene:Larp1 MGIID:1890165 Length:1091 Species:Mus musculus

Alignment Length:1476 Identity:444/1477 (30%)
Similarity:593/1477 (40%) Gaps:494/1477 (33%)


  Fly   153 KPQQAGGRRVPGSSDTERKSVRPRAPRGGSPRKSAAGAAGAAGSNAGAVSSAVPGGPKVHKDRKD 217
            :|.:|.|.|.|.....   ...||. |.|...:..:|.|||..:.......||||          
Mouse    20 EPGEAWGARAPACPGA---GCGPRR-REGRVWRRGSGRAGAGRAGDSWAPCAVPG---------- 70

  Fly   218 TSPSASIEGAGSSGNEAKSADGDQQAGEKGAAGAAPPP----KRFIAAPPPKVNAWKISAKQSG- 277
              ..|::.|                   :..|..:|||    .|::..|....:||..|....| 
Mouse    71 --LFAALAG-------------------RSCARGSPPPLSPGGRWLGNPSRARSAWASSGAPLGH 114

  Fly   278 SPKAGTS---------PLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGATT 333
            |.:.||.         ..|:|..:|                                        
Mouse   115 SLRLGTPGCLIVSMALEFDRRSPEP---------------------------------------- 139

  Fly   334 TTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKK 398
                                   ||.|....|||                            .|.
Mouse   140 -----------------------SAPAKVVRAAA----------------------------PKP 153

  Fly   399 KVNQKASDFSNVGDWPT--LIGGTSGSGKATSNEPKRN-PTKKQQSAKTAAAVAASSNTTSSEVA 460
            :...|..||.:..:|||  .|...|...::...:|.|. |.||..                    
Mouse   154 RKGSKVGDFGDAVNWPTPGEIAHKSVQPQSHKPQPARKLPPKKDM-------------------- 198

  Fly   461 TESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAG 525
             :....|..|.|..:|.:.:..:....|.            |...||..:               
Mouse   199 -KEQEKGDGSDSKESPKTKSDESGEEKNG------------DEDCQRGGQ--------------- 235

  Fly   526 PALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESR 590
               .||..||||.||.||:......:.:..||.|            |:              |.|
Mouse   236 ---KKKGSKHKWVPLQIDMKPEVPREKLASRPTR------------PQ--------------EPR 271

  Fly   591 HPHAGR-HPYGSRPAT----ATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGP 650
            |..|.| ...||.|||    :.:....:|:..:....|..|:..:.:....||.|.         
Mouse   272 HTPAVRGEMKGSEPATYMPVSVAPPTPAWQPETKVEPAWHDQDETSSVKSDGAGGA--------- 327

  Fly   651 RRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYA-NYLPADAAGADSQSSYVLMGTHYF 714
               |..:||..:|||    :|.||.......|.    :|. .|...|.........|:...|:||
Mouse   328 ---RASFRGRGRGRG----RGRGRGRGGTRTHF----DYQFGYRKFDGTEGPRTHKYMNNITYYF 381

  Fly   715 GNVPAAYI-ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTT 778
            .||.:..| .:|...:|:.||:|:|||||||||..|||||||||.:|::|:|||||||||.||||
Mouse   382 DNVSSNEIYSMDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTT 446

  Fly   779 DVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKL 843
            |:::|..|:|:|..:|:.| .|||.:..|..||:...|.|:              ..|.|..:.|
Mouse   447 DISLIFAALKDSKVVEMVE-EKVRRREEPEKWPLPGPPIVD--------------YSQTDFSQLL 496

  Fly   844 EEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISAL 908
                                            |....||     :|..:..|.:|..|..|::.:
Mouse   497 --------------------------------NCPEFVP-----RQHYQKETESAPGSPRAVTPV 524

  Fly   909 TQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKT 973
            ..:.|        .:|.|....|..|.|.||..:.:                   |.|||:|.:.
Mouse   525 PTKTE--------EVSNLKTLPKGLSASLPDLDSES-------------------WIEVKKRPRP 562

  Fly   974 NAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSA 1038
            :..:     |.:.::|                                                 
Mouse   563 SPAR-----PKKPEEP------------------------------------------------- 573

  Fly  1039 TKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAP---PSAQCHA----EKEELDFQF 1096
                                             :.|..||.|   ||.|..:    |:|||||.|
Mouse   574 ---------------------------------RFSHPTALPQQLPSQQLMSKDQDEQEELDFLF 605

  Fly  1097 DEEL--MDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAP---KHEGYDRTAD 1156
            |||:  ||      ||.|.||. :|::| ||||..|||:||:|||.|.  .|   :|.|.|||.:
Mouse   606 DEEMEQMD------GRKNTFTA-WSEED-SDYEIDDRDVNKILIVTQT--PPYMRRHPGGDRTGN 660

  Fly  1157 FTSRTKITQDLENIINDGLVNYEEDLWT---------TTNVVADYKTVNVISQADFEKLAGGRNK 1212
            .|||.|::.:|..:|||||..||:||||         ....|.::|.||:||:..|:.|.  ...
Mouse   661 HTSRAKMSAELAKVINDGLFYYEQDLWTEKFEPEYSQIKQEVENFKKVNMISREQFDTLT--PEP 723

  Fly  1213 SVLPPQVVPP-PPPFEEDLDETLVG-------DTTLNSTLNNTL--------------------- 1248
            .|.|.|.||| ||.|::...:.|..       .:|:..:|..|:                     
Mouse   724 PVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNARTPRTPRTPQLK 788

  Fly  1249 -KSRRARFY-AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGS--SAGTS 1309
             .|:..||| ......::|.:.|||||.||::|||:|:||||::|:.||||||.|:.|  |.|| 
Mouse   789 DSSQTPRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGT- 852

  Fly  1310 PTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYR 1374
            |...|||    ..|||||.||||||.|||||.|||..||||..|||.||:|||.|||||||||:|
Mouse   853 PAVGSYG----CTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFR 913

  Fly  1375 FWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADY 1439
            |||||||::|||.||.||:.||||||..|:|||||||||::|||||||||.:|::|||:||:.||
Mouse   914 FWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDY 978

  Fly  1440 ETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNP--- 1501
            |.|||||||||||||||.| .:.|::.|||.|||..|:.:|||| |:|.:.|  :|....:|   
Mouse   979 EAGQLYGLEKFWAFLKYSK-AKNLDIDPKLQEYLGKFRRLEDFR-VDPPMGE--EGNHKRHPVVA 1039

  Fly  1502 -GRQLNRHRSVSESDGTAVIAAGGRRLNTTITNRSDYVGRLLQQQH 1546
             |....|.|..|:|....  |.|..:..||.|.::.........||
Mouse  1040 GGSGEGRKRCPSQSSSRP--ATGISQPPTTPTGQATREDAKWTSQH 1083

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 47/73 (64%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 28/38 (74%)
Larp1XP_006534397.1 LARP_1_2 398..470 CDD:153403 47/73 (64%)
DM15 881..921 CDD:128927 32/40 (80%)
DM15 922..960 CDD:128927 28/38 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 591 1.000 Inparanoid score I977
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T1083832
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.