DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp6

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_080511.2 Gene:Larp6 MGIID:1914807 Length:492 Species:Mus musculus

Alignment Length:519 Identity:107/520 (21%)
Similarity:172/520 (33%) Gaps:139/520 (27%)


  Fly   603 PATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRGGF 667
            |.|....||....:.........||..|..|.|             .|.||.:|      |.|..
Mouse    12 PETTVQIRVAIQEAEDLEDLEEEDEGTSARAAG-------------DPARYLSP------GWGSA 57

  Fly   668 SRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEA 732
            |.:.|.|                .:..|..:|.::...          ::...:...|...|::.
Mouse    58 SEEEPSR----------------GHSSATTSGGENDRE----------DLEPEWRPPDEELIRKL 96

  Fly   733 IKKQVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDK 792
            : .|:|:|||.:||..|.||     |.|:   ||:.|.|:.||.:|..||.|.....:|:|.|..
Mouse    97 V-DQIEFYFSDENLEKDAFLLKHVRRNKL---GYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVT 157

  Fly   793 LELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILT 857
            |||.|.::...:|||.                                                 
Mouse   158 LELNEDHRKVRRTTPV------------------------------------------------- 173

  Fly   858 SAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGH 922
                         |..|.  :||..|||.......|..:.||.:......:.::|.....:|.|.
Mouse   174 -------------PLFPN--ENLPSKMLLVYDLHLSPKLWALATPQKNGRVQEKVMEHLLKLFGT 223

  Fly   923 LSGLAESV---KPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRS---KTNAIKENAT 981
            . |:..||   ||.....||.|..:|..:..|:....:.|.|.:...:|...   ..:..|||..
Mouse   224 F-GVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVDAAIKAHEFMVTESQSKENMK 287

  Fly   982 TPPQQQQPPLSQTL-NNNNDNVKTNNTS-SKSKSS--------SNNAPSNASSSATVCVTTNNAS 1036
            ......:||..:.| :.|:|:..|..|. |:|.:.        .:.:.:|:||......|:..|.
Mouse   288 AVLIGMKPPKKKPLKDKNHDDEATAGTHLSRSLNKRVEELQYMGDESSANSSSDPESNPTSPMAG 352

  Fly  1037 SATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEEL 1100
            ....|:.|.:.:.......:.|....::.:|...::....:...|.    ||:..|:|....|:
Mouse   353 RRHAASNKLSPSGHQNIFLSPNASPCSSPWSSPLAQRKGVSRKSPL----AEEGRLNFSTSPEI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 29/78 (37%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp6NP_080511.2 LARP_6 93..169 CDD:153402 30/80 (38%)
RRM_LARP6 184..292 CDD:240735 25/109 (23%)
Nuclear export signal. {ECO:0000250} 186..193 1/7 (14%)
Nuclear localization signal. {ECO:0000250} 296..302 2/6 (33%)
SUZ-C 468..482 CDD:289656
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121290259
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.